KEGG   Dickeya dadantii 3937: Dda3937_00292Help
Entry
Dda3937_00292     CDS       T01305                                 

Gene name
hemD
Definition
(GenBank) uroporphyrinogen III synthase
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00860  Porphyrin and chlorophyll metabolism
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01120  Microbial metabolism in diverse environments
Module
ddd_M00121  Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Dda3937_00292 (hemD)
Enzymes [BR:ddd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Dda3937_00292 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ADN00436
UniProt: E0SKN3
Position
4538562..4539302
Genome map
AA seq 246 aa AA seqDB search
MTILVTRPSPAGEQLVARLRMAGQQAYHSPLIEFSPGGELPQLPAMLQALRPGDLVFALS
QQVVEYADPALSRAGTGWPKALTYFAVGRSTGLALHTVSGLPVHYPPERATSETLLQSPA
LQQVTGKQALLLRGNGGRELLGDTLQQRGAQVRYCECYQRNPVVYDGAEQCQRWQRLGID
TLVITSGEMLQQFYTLVPDYYRTAWLPGCRVVVVSERLADMARELGWRDIRIADNADNDA
LMRALQ
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgacgattctggttacccgtccctcccctgcgggtgagcagttggtagcccgtctcaga
atggcaggccagcaggcctaccacagcccattaatcgaattttccccgggcggcgaatta
ccgcagttgcccgccatgctgcaagcgctgcgccccggcgatctggtattcgccctgtcg
caacaggttgtggaatacgcggacccggcgctatcgcgcgccggaaccggttggcccaaa
gcgctcacctattttgcggtggggcgctccaccgggctggcgctgcataccgtcagcggt
ttgccggtgcactacccgccggagcgcgcgaccagcgaaacattattgcagtcgccggcg
ctacagcaggtaaccggcaagcaggcgttgctattacgcggcaacggtggccgggaactg
ctgggcgatacgttgcagcagcgcggcgcacaggtacgttattgcgaatgctatcaacgc
aatccagtggtttacgacggcgcggaacagtgccagcgctggcaacgtctcggcatcgat
acgctggtgatcaccagcggagaaatgctgcaacagttctatactttagtgcctgattat
tatcgaactgcctggctaccgggttgccgggtcgtcgtcgtcagcgagcgtctggccgac
atggcccgcgagttgggctggcgtgatattcggatcgccgataatgcggataacgatgcg
ctgatgcgggcgctgcagtga

DBGET integrated database retrieval system