KEGG   Dickeya dadantii 3937: Dda3937_00307Help
Entry
Dda3937_00307     CDS       T01305                                 

Gene name
pldA
Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dda3937_00307 (pldA)
   00565 Ether lipid metabolism
    Dda3937_00307 (pldA)
   00590 Arachidonic acid metabolism
    Dda3937_00307 (pldA)
   00591 Linoleic acid metabolism
    Dda3937_00307 (pldA)
   00592 alpha-Linolenic acid metabolism
    Dda3937_00307 (pldA)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.4  phospholipase A2
     Dda3937_00307 (pldA)
    3.1.1.32  phospholipase A1
     Dda3937_00307 (pldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4523534..4524427)
Genome map
AA seq 297 aa AA seqDB search
MILWESTHMYKSGGIAVALMLAATAQAQEARVQEIHDAPAVPGSIIAGLLQKHDTPFILY
PYESNYLLYTYTSNINKQAIDSYSWADHARKDEVNFQLSLGFPLWRGIAGENSLLGASYT
QRSWWQMSNKSESTPFRETNYEPQVFLGWATDYRFAGWTLRDVEMGFNHQSNGRADPTSR
SWNRVYARLMAQNGNWQVEVKPWLRLHDSEDDNPDIIRYMGHYRVRVGYHWGDSIFSAEG
RYNWNTGYGGGELGWSYPISDHVRFYTKVFSGYGESLIDYNRRQTRYGIGVTLNDMF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctttgggagagtacgcacatgtataaatcaggtgggatagctgttgcgctgatg
ttggcggcgaccgcccaggcgcaggaagcccgcgttcaggaaatccatgatgcgccggcc
gtaccgggcagtattatcgccgggctgctgcagaagcacgacacgccgttcatactttac
ccttatgaaagcaactacctgctttacacctacaccagcaacatcaataaacaggcgatt
gacagctacagctgggccgaccacgctcgcaaagacgaggtgaatttccagttaagcctc
ggttttccgctgtggcgcggcattgccggggaaaactcgctgttgggcgcgtcttatacc
cagcgctcctggtggcagatgtccaacaagagcgagtccacgccgtttcgtgaaaccaac
tacgaaccgcaggtctttcttggctgggcgaccgattaccgttttgccggctggacgctg
cgcgacgtggagatggggttcaatcatcagtccaacgggcgcgccgatccgacctcgcgc
agctggaaccgggtctatgcccgtctgatggcgcagaacggcaactggcaggtggaagtg
aaaccctggctgcgcctgcatgacagcgaagacgacaacccggacatcatccggtacatg
ggccattatcgggtgcgggtcggctaccattggggggacagcattttcagcgccgaagga
cgttataactggaataccggttacggcggcggcgagcttggatggagctacccgatcagt
gatcatgtccgtttttacaccaaggtattcagcggttacggcgagtcgttgattgactac
aatcgccgccagacccgctacggcattggcgtgacgctcaacgatatgttctag

DBGET integrated database retrieval system