KEGG   Dickeya dadantii 3937: Dda3937_00307Help
Entry
Dda3937_00307     CDS       T01305                                 

Gene name
pldA
Definition
outer membrane phospholipase A
Orthology
K01058  
phospholipase A1 [EC:3.1.1.32 3.1.1.4]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycerophospholipid metabolism
Ether lipid metabolism
Arachidonic acid metabolism
Linoleic acid metabolism
alpha-Linolenic acid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ddd00564]
Metabolism; Lipid metabolism; Ether lipid metabolism [PATH:ddd00565]
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:ddd00590]
Metabolism; Lipid metabolism; Linoleic acid metabolism [PATH:ddd00591]
Metabolism; Lipid metabolism; alpha-Linolenic acid metabolism [PATH:ddd00592]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4523534..4524427)
Genome map
AA seq 297 aa AA seqDB search
MILWESTHMYKSGGIAVALMLAATAQAQEARVQEIHDAPAVPGSIIAGLLQKHDTPFILY
PYESNYLLYTYTSNINKQAIDSYSWADHARKDEVNFQLSLGFPLWRGIAGENSLLGASYT
QRSWWQMSNKSESTPFRETNYEPQVFLGWATDYRFAGWTLRDVEMGFNHQSNGRADPTSR
SWNRVYARLMAQNGNWQVEVKPWLRLHDSEDDNPDIIRYMGHYRVRVGYHWGDSIFSAEG
RYNWNTGYGGGELGWSYPISDHVRFYTKVFSGYGESLIDYNRRQTRYGIGVTLNDMF
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
ttgatcctttgggagagtacgcacatgtataaatcaggtgggatagctgttgcgctgatg
ttggcggcgaccgcccaggcgcaggaagcccgcgttcaggaaatccatgatgcgccggcc
gtaccgggcagtattatcgccgggctgctgcagaagcacgacacgccgttcatactttac
ccttatgaaagcaactacctgctttacacctacaccagcaacatcaataaacaggcgatt
gacagctacagctgggccgaccacgctcgcaaagacgaggtgaatttccagttaagcctc
ggttttccgctgtggcgcggcattgccggggaaaactcgctgttgggcgcgtcttatacc
cagcgctcctggtggcagatgtccaacaagagcgagtccacgccgtttcgtgaaaccaac
tacgaaccgcaggtctttcttggctgggcgaccgattaccgttttgccggctggacgctg
cgcgacgtggagatggggttcaatcatcagtccaacgggcgcgccgatccgacctcgcgc
agctggaaccgggtctatgcccgtctgatggcgcagaacggcaactggcaggtggaagtg
aaaccctggctgcgcctgcatgacagcgaagacgacaacccggacatcatccggtacatg
ggccattatcgggtgcgggtcggctaccattggggggacagcattttcagcgccgaagga
cgttataactggaataccggttacggcggcggcgagcttggatggagctacccgatcagt
gatcatgtccgtttttacaccaaggtattcagcggttacggcgagtcgttgattgactac
aatcgccgccagacccgctacggcattggcgtgacgctcaacgatatgttctag

DBGET integrated database retrieval system