KEGG   Dickeya dadantii 3937: Dda3937_00313Help
Entry
Dda3937_00313     CDS       T01305                                 

Gene name
pldB
Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Dda3937_00313 (pldB)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Dda3937_00313 (pldB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4517702..4518694)
Genome map
AA seq 330 aa AA seqDB search
MNPYPECLLTREWQYAAFVNGSLLDFWRQRQEGMFIGVDDVPIRFVRFTSPLHQHLVVVL
PGRTDSYVKYAEAAYDLFQCGYDVLMMDHRGQGRSGRLLKDRHRGHVKRFSDYVDDVATL
WQQQVAPGRYTKRFALAHSMGGAILAQFLARQPQAFDAVALCAPMCGILLPMPRWLVWRI
LDWAERYPAIRDYYAIGTSPWRPLPFMANVLTHSHARYRRHVRFYADDPDLRIGGPTYHW
VREALQVETQLLQQAAVIITPLLLLQAEEERVVDNRCQDAFCQALAAAGHPCADGRPYVI
RGARHDILSEKDAMRADAFGRILQHFNDYH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtatccagagtgcctgctgaccagggaatggcagtacgctgcatttgttaac
ggatcattactggatttctggcgacagcgtcaggaagggatgttcatcggcgtggatgac
gtgccgatccgtttcgtgcgttttacctcgccgttgcatcagcatctggtagtggtgttg
cctggccgcaccgacagttacgtgaaatatgccgaggcggcctacgacctgttccagtgc
ggttacgacgtgttgatgatggaccaccgtggtcaggggcgttccggccggttgctgaaa
gaccgtcatcgcgggcatgttaagcgctttagcgattatgtggacgatgtggcgacactg
tggcaacagcaggtggcgccggggcgctataccaaacggttcgcgctggcgcattcaatg
ggcggcgcgattctggcgcagtttctggcgcgtcagccgcaggcgttcgatgcggtggcg
ctttgcgcgccgatgtgcggcatcctgttgccgatgccgcgctggctggtctggcgcatt
ctcgactgggccgagcgttacccggcgatacgggactactatgccatcggcaccagcccg
tggcgcccgttgccgtttatggcgaatgtgctgacccacagccatgcgcgctatcgtcgc
catgtgcgtttttatgccgatgacccggatttgcgcatcggcggcccgacctatcactgg
gtgcgggaggcgctgcaagttgaaacgcaactgttacaacaggcggcggtgattataacg
cctctgctgctgttgcaggcggaagaggagcgggtggtggataaccgctgtcaggacgcc
ttttgtcaggcgctggcggcagccggccacccgtgtgcggatggccgaccttacgtcatt
cgcggcgctcgtcacgacatcctgtcggaaaaggatgcgatgcgggccgacgccttcggg
cggattttgcaacatttcaacgattatcattaa

DBGET integrated database retrieval system