KEGG   Dickeya dadantii 3937: Dda3937_00313Help
Entry
Dda3937_00313     CDS       T01305                                 

Gene name
pldB
Definition
lysophospholipase L(2)
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:ddd00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4517702..4518694)
Genome map
AA seq 330 aa AA seqDB search
MNPYPECLLTREWQYAAFVNGSLLDFWRQRQEGMFIGVDDVPIRFVRFTSPLHQHLVVVL
PGRTDSYVKYAEAAYDLFQCGYDVLMMDHRGQGRSGRLLKDRHRGHVKRFSDYVDDVATL
WQQQVAPGRYTKRFALAHSMGGAILAQFLARQPQAFDAVALCAPMCGILLPMPRWLVWRI
LDWAERYPAIRDYYAIGTSPWRPLPFMANVLTHSHARYRRHVRFYADDPDLRIGGPTYHW
VREALQVETQLLQQAAVIITPLLLLQAEEERVVDNRCQDAFCQALAAAGHPCADGRPYVI
RGARHDILSEKDAMRADAFGRILQHFNDYH
NT seq 993 nt NT seq  +upstreamnt  +downstreamnt
atgaatccgtatccagagtgcctgctgaccagggaatggcagtacgctgcatttgttaac
ggatcattactggatttctggcgacagcgtcaggaagggatgttcatcggcgtggatgac
gtgccgatccgtttcgtgcgttttacctcgccgttgcatcagcatctggtagtggtgttg
cctggccgcaccgacagttacgtgaaatatgccgaggcggcctacgacctgttccagtgc
ggttacgacgtgttgatgatggaccaccgtggtcaggggcgttccggccggttgctgaaa
gaccgtcatcgcgggcatgttaagcgctttagcgattatgtggacgatgtggcgacactg
tggcaacagcaggtggcgccggggcgctataccaaacggttcgcgctggcgcattcaatg
ggcggcgcgattctggcgcagtttctggcgcgtcagccgcaggcgttcgatgcggtggcg
ctttgcgcgccgatgtgcggcatcctgttgccgatgccgcgctggctggtctggcgcatt
ctcgactgggccgagcgttacccggcgatacgggactactatgccatcggcaccagcccg
tggcgcccgttgccgtttatggcgaatgtgctgacccacagccatgcgcgctatcgtcgc
catgtgcgtttttatgccgatgacccggatttgcgcatcggcggcccgacctatcactgg
gtgcgggaggcgctgcaagttgaaacgcaactgttacaacaggcggcggtgattataacg
cctctgctgctgttgcaggcggaagaggagcgggtggtggataaccgctgtcaggacgcc
ttttgtcaggcgctggcggcagccggccacccgtgtgcggatggccgaccttacgtcatt
cgcggcgctcgtcacgacatcctgtcggaaaaggatgcgatgcgggccgacgccttcggg
cggattttgcaacatttcaacgattatcattaa

DBGET integrated database retrieval system