KEGG   Dickeya dadantii 3937: Dda3937_00384Help
Entry
Dda3937_00384     CDS       T01305                                 

Gene name
dnaJ
Definition
chaperone Hsp40, co-chaperone with DnaK
Orthology
K03686  
molecular chaperone DnaJ
Organism
ddd  Dickeya dadantii 3937
Brite
Mitochondrial biogenesis [BR:ddd03029]
 Mitochondrial protein import machinery
  Matrix
   Other matrix factors
    Dda3937_00384 (dnaJ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4194484..4195617)
Genome map
AA seq 377 aa AA seqDB search
MAKQDYYEILGVAKDADEREIKKAYKRLAMKYHPDRNPGDKDAEAKFKEVKEAYEILTDA
QKRAAYDQYGHAAFEQGGMGGGGAGGFGGADFGDIFGDVFGDIFGGGRRQRASRGSDLRY
TMELTLEEAVRGVTKEIRIPTLQECDVCHGSGARPGSSAVTCPTCHGNGQVQMRQGFFTV
QQTCPHCHGRGKIIKDPCAKCHGHGRVEKSKTLSVKIPAGVDTGDRIRLAGEGEAGEFGA
PAGDLYVQVQVREHPIFQREDNNLYCEVPINFAMAALGGEIEVPTLDGRVMLKVPAETQT
GKLFRMRGKGVKSVRGGMQGDLLCRVVVETPVNLSDRQKQLLQELQESFGGPTGESNSPR
SKSFFDGVKKFFDDLTR
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
atggcgaagcaagactactacgagattctgggcgttgcgaaagacgcagatgaacgtgaa
atcaaaaaggcttacaaacggctggcgatgaaatatcacccggatcgcaatccgggcgac
aaagacgccgaggccaaatttaaggaagtcaaagaagcctatgagattttgaccgatgct
cagaaacgcgctgcctacgatcagtatggacatgccgcgtttgagcagggcggtatgggc
ggcggcggcgcaggtggtttcggcggcgctgatttcggcgatattttcggcgacgttttc
ggtgatatctttggcggcggtcgccgtcagcgtgcgagccgcggctctgatttacgctac
accatggagctgacgctggaagaagcggtacgcggcgtcaccaaagagatccgtatcccg
acgctacaggaatgcgatgtttgtcatggcagcggcgccagaccgggcagcagcgcggtg
acctgtccaacctgtcacggtaacgggcaggtgcagatgcgtcaggggttcttcacggtg
cagcaaacctgtccgcactgtcatggccgcggcaagatcatcaaagatccttgcgcgaag
tgtcatggtcacgggcgcgttgagaaaagcaaaacgctgtcggtcaagatcccggccggc
gtggacaccggcgatcgcatccgcctggcgggtgaaggggaagcaggggaatttggcgcc
ccggctggcgatctgtacgtacaggtgcaggtacgcgaacacccgatcttccagcgcgaa
gacaacaacctctactgtgaagtgccgatcaacttcgccatggcggcgttgggcggtgaa
attgaagtgccgacgctggatggccgcgtgatgttgaaagtgccggcggaaacgcaaacc
ggcaagctgttccgcatgcgcggcaaaggcgtgaagtcggtacgcggcggtatgcagggc
gacctgctgtgccgggtggtggtggaaaccccggtcaacctgagcgatcgtcaaaaacag
ctgttgcaggaactgcaggaaagcttcggtggcccgactggcgaaagcaacagcccacgt
tccaaaagtttcttcgacggcgtgaagaaattctttgacgacctgacgcgctga

DBGET integrated database retrieval system