KEGG   Dickeya dadantii 3937: Dda3937_00392Help
Entry
Dda3937_00392     CDS       T01305                                 

Gene name
thrC
Definition
(RefSeq) threonine synthase
  KO
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dda3937_00392 (thrC)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dda3937_00392 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Dda3937_00392 (thrC)
Enzymes [BR:ddd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Dda3937_00392 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4204506..4205795)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVNFAEAIRKGLGSNQGLFFPLELPEFDRTTIDELLEQDFVTRSSRILS
AFIGDEMSDETVYQRVKAAFRFPAPVVPVSEDIAALELFHGPTLAFKDFGGRLMAQMLAE
VAGDQQITILTATSGDTGAAVAHAFYGLKNVRVVILYPNGKISPLQEKLFCTLGGNIHTI
AVDSDFDACQALVKQAFDDEELKRAIGLNSANSINISRLLAQISYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLQNGSWQPNPTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKELAFGAVSDETTKATMLELEALGYTSEPHAAIAYRL
LRDQLQPGEYGLFLGTAHPAKFKESVEEILGKALPLPTALAERADQPLLSHHFAPDFAQL
RKFLMELPH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatctgaaagatcacaatgaacaggtgaatttcgccgaagcgatccgc
aaagggctgggaagtaatcagggcctgtttttcccgctggagctgccggaattcgaccgc
acgacgattgatgaactgctggagcaggattttgtcacccgcagcagccgcattctgtcg
gcgttcattggtgatgaaatgtccgatgaaaccgtctatcagcgcgttaaagcggctttc
cgttttccggcgccggtagtcccggtgagcgaggacatcgccgcgctggagctgtttcac
ggcccgacgctggcgttcaaggacttcggcggccgcctgatggcgcagatgctggcggaa
gtcgcgggcgaccaacagatcacgattctgaccgccacctcgggcgacaccggcgcggcg
gtcgcgcatgcgttttacggcctgaagaatgtgcgggtggtgattctgtacccgaacggc
aagatcagcccgttgcaggaaaaactgttctgtacgctgggcggcaatatccacactatc
gccgtcgacagcgatttcgacgcctgtcaggcgctggtgaaacaagcgttcgatgacgaa
gaactgaaacgtgcgatagggctgaactccgccaactccatcaacatcagccgtctgctg
gcgcagatcagctactacttcgaagcggtggcgcagttgccgcaggaagcccgcaatcaa
ctagtgatctcggtgccgagcggcaacttcggtgacctgacagccggtctgctggcgaaa
tctctgggcttgccggtgaaacgttttatcgccgccaccaacgccaacgacacagtgccg
cgttttctgcaaaacggaagctggcaaccgaatccgacggtggcgacgttgtccaacgcg
atggatgtgagccagccgaacaactggccgcgagtggaagaattgtttcgtcgcaagaac
tggcaactgaaggaactggcgttcggtgcggtgagcgatgagacaaccaaagctaccatg
ttggaactggaggcgttgggatatacctctgagccgcatgcggcgattgcgtaccgtttg
ttgcgcgatcagttgcagccgggcgagtacggcctgttcctgggcaccgcccatccggcg
aagttcaaggagagcgtggaggagattcttggtaaggcactgccgttgccgaccgcgctg
gctgaacgcgccgaccagccgctgctgtcacaccacttcgcgccggacttcgcgcagttg
cgcaaattcctgatggaactgccgcactaa

DBGET integrated database retrieval system