KEGG   Dickeya dadantii 3937: Dda3937_00392Help
Entry
Dda3937_00392     CDS       T01305                                 

Gene name
thrC
Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddd01230]
Metabolism; Amino acid metabolism; Glycine, serine and threonine metabolism [PATH:ddd00260]
Metabolism; Metabolism of cofactors and vitamins; Vitamin B6 metabolism [PATH:ddd00750]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4204506..4205795)
Genome map
AA seq 429 aa AA seqDB search
MKLYNLKDHNEQVNFAEAIRKGLGSNQGLFFPLELPEFDRTTIDELLEQDFVTRSSRILS
AFIGDEMSDETVYQRVKAAFRFPAPVVPVSEDIAALELFHGPTLAFKDFGGRLMAQMLAE
VAGDQQITILTATSGDTGAAVAHAFYGLKNVRVVILYPNGKISPLQEKLFCTLGGNIHTI
AVDSDFDACQALVKQAFDDEELKRAIGLNSANSINISRLLAQISYYFEAVAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPVKRFIAATNANDTVPRFLQNGSWQPNPTVATLSNA
MDVSQPNNWPRVEELFRRKNWQLKELAFGAVSDETTKATMLELEALGYTSEPHAAIAYRL
LRDQLQPGEYGLFLGTAHPAKFKESVEEILGKALPLPTALAERADQPLLSHHFAPDFAQL
RKFLMELPH
NT seq 1290 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtacaatctgaaagatcacaatgaacaggtgaatttcgccgaagcgatccgc
aaagggctgggaagtaatcagggcctgtttttcccgctggagctgccggaattcgaccgc
acgacgattgatgaactgctggagcaggattttgtcacccgcagcagccgcattctgtcg
gcgttcattggtgatgaaatgtccgatgaaaccgtctatcagcgcgttaaagcggctttc
cgttttccggcgccggtagtcccggtgagcgaggacatcgccgcgctggagctgtttcac
ggcccgacgctggcgttcaaggacttcggcggccgcctgatggcgcagatgctggcggaa
gtcgcgggcgaccaacagatcacgattctgaccgccacctcgggcgacaccggcgcggcg
gtcgcgcatgcgttttacggcctgaagaatgtgcgggtggtgattctgtacccgaacggc
aagatcagcccgttgcaggaaaaactgttctgtacgctgggcggcaatatccacactatc
gccgtcgacagcgatttcgacgcctgtcaggcgctggtgaaacaagcgttcgatgacgaa
gaactgaaacgtgcgatagggctgaactccgccaactccatcaacatcagccgtctgctg
gcgcagatcagctactacttcgaagcggtggcgcagttgccgcaggaagcccgcaatcaa
ctagtgatctcggtgccgagcggcaacttcggtgacctgacagccggtctgctggcgaaa
tctctgggcttgccggtgaaacgttttatcgccgccaccaacgccaacgacacagtgccg
cgttttctgcaaaacggaagctggcaaccgaatccgacggtggcgacgttgtccaacgcg
atggatgtgagccagccgaacaactggccgcgagtggaagaattgtttcgtcgcaagaac
tggcaactgaaggaactggcgttcggtgcggtgagcgatgagacaaccaaagctaccatg
ttggaactggaggcgttgggatatacctctgagccgcatgcggcgattgcgtaccgtttg
ttgcgcgatcagttgcagccgggcgagtacggcctgttcctgggcaccgcccatccggcg
aagttcaaggagagcgtggaggagattcttggtaaggcactgccgttgccgaccgcgctg
gctgaacgcgccgaccagccgctgctgtcacaccacttcgcgccggacttcgcgcagttg
cgcaaattcctgatggaactgccgcactaa

DBGET integrated database retrieval system