KEGG   Dickeya dadantii 3937: Dda3937_00489Help
Entry
Dda3937_00489     CDS       T01305                                 

Gene name
yfcX
Definition
enoyl-CoA hydratase/Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase/3-hydroxyacyl-CoA dehydrogenase/3-hydroxybutyryl-CoA epimerase
Orthology
K01782  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
ddd  Dickeya dadantii 3937
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dda3937_00489 (yfcX)
   01212 Fatty acid metabolism
    Dda3937_00489 (yfcX)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dda3937_00489 (yfcX)
   00650 Butanoate metabolism
    Dda3937_00489 (yfcX)
  Lipid metabolism
   00071 Fatty acid degradation
    Dda3937_00489 (yfcX)
   01040 Biosynthesis of unsaturated fatty acids
    Dda3937_00489 (yfcX)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dda3937_00489 (yfcX)
   00310 Lysine degradation
    Dda3937_00489 (yfcX)
   00380 Tryptophan metabolism
    Dda3937_00489 (yfcX)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dda3937_00489 (yfcX)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dda3937_00489 (yfcX)
   00281 Geraniol degradation
    Dda3937_00489 (yfcX)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Dda3937_00489 (yfcX)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dda3937_00489 (yfcX)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dda3937_00489 (yfcX)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Dda3937_00489 (yfcX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3340952..3343192)
Genome map
AA seq 746 aa AA seqDB search
MRGGRPGGSDGAGGDAMTELNAIHQAHEHEEHAAFRLTLRPDHIGVITVDVPGEKVNTLK
AEFAEQMRAVLTQARQHSGLQGLVILSGKPASFIAGADIGMLDACSDAAAAQALAETGQE
ALEALAHLPFPVVAAIHGACLGGGLELALACDYRLCTPDDSTRLGLPEVQLGLLPGAGGT
QRLPRLIGVDRALELILTGRQLRAAQARRLGLVDEVVPHAVLLEAALGFIRRGKRLPSSP
GWRHRLLMLPYVRRWLFERVRRQTQAKTQGNYPATARILAVVRRGLEQGSQAGYQAEARA
FGRLVMSPESVALRRLFFTATALKKDQGAPVEPGPLRRVGVLGGGLMGGGIAGVTALNGQ
LPVRIKDIHEQGITHALRNSWQRLSKQVARRRITPAEQRWQMSLISGGTDYRGFERVDVV
VEAVFEEVALKQQMVRETEAVTPPHTVFATNTSSLPIHQIAAGAGRPEQVIGLHYFSPVD
KMPLVEVIPHAGTSEQTLSTTVALAKKQGKTAIVVADKAGFYVNRILAPYLNEAARCLLE
GEPVESVDQALVRFGFPVGPFTLLDEVGIDVAMKIVPVLVAELGERFCAPPALEAIARDN
RKGRKNGRGFYRYDQSRYERLCGLWRRQGNVSDGSLYPLLDVTPKAHLDPALIAQRCVMM
MLNEAVRCLDEGVIRRPGDGDIGAVMGIGFPPFLGGPFHYMNRLGIETVVATLLSLQAQY
GDRFAPAEGLLRRQSQQVDFADETER
NT seq 2241 nt NT seq  +upstreamnt  +downstreamnt
ttgcgcggcgggcggcctgggggcagcgatggtgctggaggtgacgcaatgaccgaactg
aatgcgatacatcaggcgcacgaacatgaagagcacgcggctttccggttgacgctacgc
cccgatcatatcggcgtgatcaccgtggatgttcccggcgagaaagtgaataccctgaaa
gcggaattcgcggaacagatgcgcgcggtgctgacgcaggctcgacagcacagtggccta
caggggctggttattctctccggcaaaccggcgtcgtttatcgccggggcggatatcggc
atgttggatgcctgttccgacgcggcggcggcgcaggcgctggctgaaaccgggcaggaa
gcgctggaagcgctcgcccacctgccgttcccggtggtggcggctattcacggcgcctgt
ctgggcggcgggctggaactggcgctggcttgcgattatcgcctctgtacgccggacgac
agcacccgcctcgggttgccggaagtgcaattggggctattgccgggcgctggcggcacc
cagcggcttccgcgcctgattggcgtggaccgcgcgctggagttgatcctgaccgggcgg
caactgcgggcggctcaggcgcggcggctcgggttggtggatgaagtggtgccgcacgcc
gtattgctggaggcggcgctgggctttattcgccgcggtaaacggctgccgtcctcgccc
ggctggcggcaccggctactgatgctgccttacgtacgccgctggctgtttgagcgggtg
cggcggcagacgcaggcgaaaactcagggcaattacccggcgacggcgcgtattctggcg
gtggtgcgccggggtctggaacaaggtagccaggcaggctatcaggcggaggcccgcgct
ttcggccgactggtgatgtcgccggagtcggtggcgttgcggcgactgttttttaccgcc
accgcgctgaaaaaagatcagggcgcgccggtcgagcctggtccactgcgccgggttggg
gtgttgggcggcggtttgatgggcggcggcattgccggcgtcaccgcgctgaatggtcaa
ttgccggtaaggatcaaagatattcatgagcaaggcatcacccatgcgctgcgcaacagc
tggcagcggttgagcaaacaggtggcgcgccgccgcatcacgcccgcagagcagcgatgg
cagatgagcctgatttccggcggcaccgattaccggggatttgagcgcgttgatgtggtg
gtggaggcggtattcgaagaggtggcgctcaaacagcagatggtgcgggaaaccgaagcg
gtaacgccgccgcatacggtgtttgccaccaatacctcgtcgctgccgattcatcagatc
gccgccggtgccggtcggcctgagcaggtgataggcctgcactatttcagcccggtggac
aagatgccgctggttgaggttattccccatgccggaaccagcgagcagacgctgtccacc
acggtggcgctggcgaagaagcagggtaaaaccgccatcgtagtggcggataaagctggg
ttttatgttaaccgcattctggcgccttacctgaatgaggcggcccgctgtttgctggaa
ggcgagccggtagaatcggtcgatcaggcgctggtgcgtttcggtttcccggtcgggcct
tttaccttgctggatgaagtggggattgatgtggcgatgaagattgtgccggtgctggtg
gcggagctgggcgagcggttttgcgcgccgccggcgctggaagccattgcccgcgacaac
cgtaaaggccgtaagaacggacgcggcttttatcgctacgatcagtcgcgttatgagcgg
ttatgcggtttgtggcggcgtcagggcaacgtgtccgacggtagtctctatcccttgctg
gatgtgacgcccaaagcgcacctggatccggcgctgattgcgcagcgctgcgtcatgatg
atgctgaatgaagcggtgcgctgtctggatgaaggggtgatccgccgcccgggcgacggc
gacatcggcgcggtaatggggatcgggtttccaccgtttctgggcggcccattccactac
atgaatcgattagggatagaaacagtggtggcaaccctgctgtcgttgcaggcgcagtat
ggcgatcggtttgcgccggcggaaggactgctccggcggcagtcacagcaggttgacttt
gctgatgaaacggaacgctaa

DBGET integrated database retrieval system