KEGG   Dickeya dadantii 3937: Dda3937_00572Help
Entry
Dda3937_00572     CDS       T01305                                 

Gene name
trpA
Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00260  Glycine, serine and threonine metabolism
ddd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01130  Biosynthesis of antibiotics
ddd01230  Biosynthesis of amino acids
Module
ddd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dda3937_00572 (trpA)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dda3937_00572 (trpA)
Enzymes [BR:ddd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dda3937_00572 (trpA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Trp_syntA His_biosynth ThiG
Motif
Other DBs
NCBI-ProteinID: ADM98429
UniProt: E0SBW1
Position
complement(2354808..2355617)
Genome map
AA seq 269 aa AA seqDB search
MERYHALFKRLSEKQEGAFVPFVTLGDPSPELSLRIIDALVAAGADALELGIPFSDPLAD
GPTIQNAALRAFAAGVTPAHCFEMLATIRQKYPDLPIGLLMYANLVFSNGIDAFYQRCAE
TGVDSVLVADVPVEESAPFRAAAMKHGVAPIFICPPNADDDLLREISSFGRGYTYLLSRA
GVTGAETRAQLPLHHLLEKLQEYHAAPPLLGFGISEPSQVQKALESGAAGAISGSAIVKI
IEQYHAQPDEMLAKLTDFVRGMKAATRTR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atggaacgctaccacgctttgtttaaacggctgtcggaaaaacaggaaggggcgtttgtg
ccgtttgtcacgctgggcgacccatcccccgagctttcgctgcgcattatcgacgcgctg
gtggccgcgggtgccgacgcgctggaactggggattccgttctccgacccgctggcggac
ggcccgaccattcagaacgccgcgctgcgcgctttcgccgccggcgtcactccggcccac
tgttttgaaatgctggcgaccatccgccagaaataccctgacctgcctatcggcttgtta
atgtacgccaatctggtgtttagcaacggtatagacgccttttaccagcgttgcgccgaa
accggcgttgattcagtgctggtagccgacgtaccggtggaagaatcggcgccgtttcgc
gcagcggcgatgaagcatggcgtcgcgcccatctttatctgcccgccgaatgcggacgac
gacctgctgcgtgaaatttcatcctttggccgtggttatacctacctgctctcccgagca
ggcgtaaccggcgcggaaacccgcgcccaactgccgttgcaccatctgctggaaaaattg
caggaataccacgcggccccgccgctgcttggtttcggcatttccgagccgtcgcaggtg
caaaaagcgctggaatccggcgcggccggcgccatctccggctcagcgattgtcaaaatc
atcgagcaataccatgcccagccggatgaaatgctcgcaaaactgaccgattttgtccgc
ggtatgaaagccgccacccgcacacgctaa

DBGET integrated database retrieval system