KEGG   Dickeya dadantii 3937: Dda3937_00573Help
Entry
Dda3937_00573     CDS       T01305                                 

Gene name
trpB
Definition
(GenBank) tryptophan synthase, beta subunit (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dda3937_00573 (trpB)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Dda3937_00573 (trpB)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dda3937_00573 (trpB)
Enzymes [BR:ddd01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Dda3937_00573 (trpB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(2355617..2356807)
Genome map
AA seq 396 aa AA seqDB search
MTLLNPYFGEFGGQYVPQILMPALRQLEEAFVNAQRDPAFQAEFSDLLKNYAGRPTALTL
CKNLTAGTRTKLYLKREDLLHGGAHKTNQVLGQALLARRMGKTEIIAETGAGQHGVATAL
ACALLGLKCRVYMGAKDVERQSPNVFRMRLMGAEVIPVHSGSATLKDACNEALRDWSGSY
ETAHYLLGTAAGPHPYPTIVREFQRMIGEETKAQVKEREGRLPDAVLACVGGGSNAIGMF
ADFIDEPSVRLIGVEPAGLGIETGQHGAPLKHGRVGIYFGMKSPMMQTEDGQIEESYSIS
AGLDFPSVGPQHAHLSSIGRADYVSITDDEALTAFRELSRHEGIIPALESSHALAHALKM
IKAEPEKEQILVVNLSGRGDKDIFTVHDILKSRGEI
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacgttacttaatccttattttggtgaatttggtggtcagtacgtaccacagatcctg
atgccggccctgcgtcagttggaagaggcatttgtcaacgcgcagcgcgacccggcgttt
caggccgaattcagcgacctgctgaaaaactacgccggacggccgacagcgctgactttg
tgtaagaacctgaccgccggcacccgcaccaaactctatctgaaacgcgaagatctgttg
cacggcggcgcgcacaagaccaaccaggtactcgggcaggcgctgcttgccaggcgcatg
ggtaaaaccgaaatcatcgccgaaaccggcgccggccaacatggcgtcgccaccgcgctg
gcctgcgccctgctggggctgaaatgccgtgtgtacatgggcgccaaagacgtggaacgc
cagtcgccgaacgtgttccgcatgcggttgatgggcgcggaagtgattccggtacacagc
ggttccgccaccctgaaagacgcctgcaacgaggcgctgcgcgactggtctggcagctat
gaaaccgcccattacctgctgggcaccgctgctggtccacacccttaccccaccatcgtg
cgggaatttcagcgcatgatcggcgaggaaactaaagcccaggtgaaagaaagagaaggt
cgtctgccggatgcggtactggcctgcgtcggcggcggctccaacgccatcggcatgttt
gctgatttcatcgacgagccgtcggtgcggttgatcggcgtggaaccagcaggattgggt
atcgaaaccgggcagcacggcgcaccgctgaaacacggtcgcgtcggtatctacttcggt
atgaaatcaccgatgatgcagaccgaagacggccagatcgaagagtcgtactccatttcg
gccggtctggacttcccctccgtcgggccgcagcacgcgcacctgagcagcatcgggcgg
gcggattatgtgtcgatcaccgacgatgaagcgttgaccgcattccgggaattgtcgcgt
cacgaagggatcatcccggcgctggaatcctcccatgcactggcccatgcgctgaaaatg
atcaaagcggaaccggaaaaagagcaaattctggtggtcaacctgtccggccgtggcgat
aaagacatttttacggttcacgacattctgaaatcccggggagagatttga

DBGET integrated database retrieval system