KEGG   Dickeya dadantii 3937: Dda3937_00574Help
Entry
Dda3937_00574     CDS       T01305                                 

Gene name
trpC
Definition
(GenBank) Indole-3-glycerol phosphate synthase / Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00400  Phenylalanine, tyrosine and tryptophan biosynthesis
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01130  Biosynthesis of antibiotics
ddd01230  Biosynthesis of amino acids
Module
ddd_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Dda3937_00574 (trpC)
Enzymes [BR:ddd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Dda3937_00574 (trpC)
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Dda3937_00574 (trpC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ADM98431
UniProt: E0SBW3
Position
complement(2356825..2358210)
Genome map
AA seq 461 aa AA seqDB search
MQETVLTKIVRDKAQWIAERQQRQPLDSFQSQVTPSSRHFYQSLKQASPAFILECKKASP
SKGLIRADFDPVAIARVYQDYASAISVLTDEKYFQGDFAFLTQVSAAVAQPVLCKDFIID
PYQIYLARYYQADAILLMLSVLDDAQYRQLAQVAHSLNMGILTEVSNEAELERAIALEAR
VVGINNRDLRDLSIDLNRTRTLAPRLPAGVTVISESGISRHAHIQELSQYANGFLIGSSL
MEEHDLTLAVRRVILGENKVCGLTRPDDATAAFQAGAVYGGLIFVADSPRYVTTSQARAV
MAGAPLRYVGVFRDAPLADIVATASSLQLAAVQLHGHEDQAAIAALREQLPATCQIWKAH
SVGDTLPPLTLAQVDRVLLDNGKGGSGQSFDWSLLQGQSLQQVLLAGGLGPSNVAQAATL
GVAGLDFNSGVESQPGIKDPQKIAAVFRTLRTAQPCRTSHE
NT seq 1386 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaaccgtattaaccaaaattgtgcgcgacaaagcgcagtggatcgccgaacgg
cagcaacgacagccgctcgacagctttcagtcacaggtaacgcccagctcgcgccacttc
tatcagtcgctgaaacaggccagtccggcgtttatcctggagtgcaaaaaggcctcgcca
tccaaggggttgattcgcgccgatttcgacccggtcgccattgcgcgggtttatcaggat
tacgcgtccgccatttcggtactgaccgacgagaagtattttcagggcgattttgctttc
ctcacgcaggtcagcgcggcggtggcccagccggtgctgtgcaaggacttcattatcgac
ccgtaccagatctatctggctcgttactatcaggccgatgcgattctgctaatgctgtcg
gtgctggatgatgcacagtatcgccaactggcgcaggtagcgcacagcctgaatatgggc
atcctgacggaagtcagcaatgaagccgaactggaacgcgctatcgcgctggaagcgcgc
gtggtcggcatcaacaaccgcgacctgcgcgatctctctatcgatctgaaccgtacccgc
acgctggcgccgcgtctgccggctggagtgacggtgatcagcgaatccggcatcagccgc
cacgcccatattcaggaactgagccagtacgccaatggctttctgatcggcagttcgctg
atggaagaacacgatctgacgctggcagtacgccgggtcatcctcggcgaaaacaaggtg
tgcgggctgacccgccccgacgatgccaccgcggcctttcaggccggcgcggtgtacggc
gggctgattttcgtcgctgactccccgcgctacgtgacaacgtcacaggcacgtgccgtg
atggcgggtgcgcccttacgttatgtcggcgtattccgtgacgcgccgctggccgacatc
gtggcaaccgcgtcgtcgctccagctggctgcggttcagttacacggccacgaagaccaa
gccgccatcgccgccttgcgtgagcaactgcccgcaacctgccagatctggaaagcgcac
agcgtcggcgacactctgcccccattaacgctggcgcaggttgaccgggtgctgctcgac
aacggcaaaggcggcagtggtcagtcgttcgactggtcattgctgcagggtcaatcgctg
caacaggtgctgctggccggcggcctcggcccgagcaacgtggcacaggccgcaacactc
ggcgtcgccgggctggatttcaactctggcgtggagtcgcaacccggcatcaaagatccg
caaaaaatcgcggcggtattccggacgctgcgtacggcacaaccgtgccgtacctctcat
gaataa

DBGET integrated database retrieval system