KEGG   Dickeya dadantii 3937: Dda3937_00746Help
Entry
Dda3937_00746     CDS       T01305                                 

Gene name
lacZ
Definition
beta-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ddd  Dickeya dadantii 3937
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dda3937_00746 (lacZ)
  Lipid metabolism
   00600 Sphingolipid metabolism
    Dda3937_00746 (lacZ)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Dda3937_00746 (lacZ)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dda3937_00746 (lacZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1662247..1665360)
Genome map
AA seq 1037 aa AA seqDB search
MSTASAYAPLSDISLADILARRDWENPACPHVRRLDAHPPFSSWRGLDAARDDQPSERRQ
QLNGAWTFSYFPRPEAVPEQWLTQDLTDADAITVPSNWQLAGYDAPIYTNIKYPIPVNPP
FVPQDNPTGCYSLTFSVNADWLTQGQTRIVFDGVNSAFHLWCNGKWVGYSQDSRLPAEFD
LTPCLQPGENRLAVMVLRWSDGTYLEDQDMWRMSGIYRDVYLLHKPAVHLRDVQLTTPLR
HSYTQGTLCVTAQANLPEDQAQAWRLNVQLWRDGQLVGERRAPFGTPAIDERGAYHDRVN
LQIEVERPALWSAEEPNLYRAVVALEYADGTLAEAEAYDVGFREVAIRNGLLLLNGQPLL
IRGVNRHEHHPQRGQAIDEATMRQDILLMKQHNFNAVRCSHYPNHPLWYRLCDYYGLYVV
DEANIETHGMQPMSRLSDDPRWLPAYAERVTRMVQRDRNHPCIIIWSLGNESGYGPTHSA
LYQWVKQQDPSRPVQYEGGGANTPATDILCPMYARVDQDQPFPAVPKWSIKKWIGLPGEN
RPLILCEYAHAMGNSFGGFDRYWQAFRQYPRLQGGFVWDWVDQALLREQDGKTHWAYGGD
FGDKPNDRQFCLNGLVFPDRTPHPALYEAQRAQQFFQFTRHESAPLTLTVTSEYLFRHSD
NEELRWRIMQDDVPLASGTVPLDIAPQGCQTLTLLDQLPAPQHHADMWLTVEVVQPHATD
WSPAEHRCAWDQWPLPMPLAHSAPHRNDGACPTLTRDDDHFDIIHDQQRWSFDRRSGLLT
QWWRDGQPQLLSPLQDNLTRAPLDNDIGISEVDRIDPNAWVERWKLAGLYQYQTDCRQIR
ADTLSDSVLITTEHVGHYQQQTLFISRKQWRIDAQGVLTVSVEVDVARHLPPLARIGLYG
QLAAVNPQVSWLGLGPHENYPDRRLAALHGRWQQPLEAMHTPYIFPSENGLRCHTRELRY
GDWLIEGDFHFGISRYSLQQLMDCTHQHLLQPEPGTWLNLDGFHMGIGGDDSWSPSVAPN
FLLTAPRYRYQLQLRLQ
NT seq 3114 nt NT seq  +upstreamnt  +downstreamnt
atgtccactgcttccgcttatgctcctctatccgacatctcgctggcggatattctggcc
agacgtgactgggaaaatccggcttgcccccatgttcgccggctggacgcacacccgccg
ttttccagctggcgcggcctcgacgcagcccgtgacgaccagccttccgagcggcgtcag
cagctgaacggcgcatggaccttcagctatttcccacgcccggaagcggtgccggaacag
tggctgacgcaggacctgaccgacgctgatgctattaccgtgccgtccaactggcagttg
gcgggttacgatgcgccgatttacaccaacatcaaatacccgataccggtcaacccgccg
ttcgtcccgcaagacaatcccaccggttgttattcgctcacattttcagttaacgccgac
tggctgacgcagggccagacccgcatcgtgttcgacggcgtcaactccgcctttcacctg
tggtgcaacggcaaatgggtcggctactcccaggacagccggctgccggcggagttcgac
ctgacgccctgcctgcagccgggagaaaaccggctggcggtgatggtgctgcgctggtct
gacggcacctatctggaagatcaggacatgtggcgcatgagcggcatttaccgcgatgtc
tacctgctgcacaaaccggcggtgcatctgcgcgatgtgcaactcaccaccccactgcgc
cacagctacacacagggcacgctgtgcgtgacagcgcaggccaacctgccggaagatcag
gcgcaggcgtggcgactgaatgtgcaactgtggcgcgacgggcaattggtgggtgaacgc
cgcgcgccgtttggcacgccggcgatcgacgaacgcggcgcctatcacgaccgggtgaac
ctgcaaatagaggtggagcggcctgcgctgtggagcgcggaagagcccaatctgtaccgg
gcggtggtggcgctggaatacgccgacggcacgctggcggaagcggaagcctatgacgtc
ggctttcgcgaggtcgctatccgtaacggcctgctgctgctcaatggtcagccactgctg
attcgcggcgtcaaccgccatgaacatcatccgcaacgcggtcaggccatcgacgaagcg
accatgcggcaggatattctgttaatgaagcaacacaacttcaacgcggtgcgctgctcc
cactaccccaatcatccgttatggtatcggctgtgcgactactacggtctgtatgtagta
gacgaagcgaatatcgagacccacggcatgcagccgatgagccgcctgtccgacgacccg
cgctggctgccggcttacgccgagcgggttacccgcatggtacagcgcgaccgcaaccat
ccctgcatcattatctggtcgctgggcaacgagtccggctacggcccaacccacagcgcg
ctctaccagtgggtgaaacagcaggacccaagccggccggtgcaatacgaaggcggcggc
gccaacacgcccgccaccgatattctgtgcccgatgtacgcccgggtggatcaggaccag
ccgttcccggcggtaccgaagtggtcgataaaaaaatggatcggtctgccgggagaaaac
cggccgctgatcctgtgcgaatacgcgcacgccatgggcaacagctttggcgggttcgac
cgttactggcaggcgttccgtcaatatccgcgtctgcaaggcggcttcgtctgggactgg
gtggatcaggcgctgctacgtgagcaggatggtaaaacgcactgggcctacggcggcgat
ttcggcgataaacccaacgatcgtcagttctgcctcaacggtctggtgtttcccgaccgt
acgccgcacccagcgctgtatgaagcccaacgcgcccagcagtttttccagttcacccgc
catgaaagcgccccgctgacgctgaccgtcaccagcgaatacctgttccgtcatagcgat
aacgaggaactgcgctggcgcatcatgcaggatgacgtgccactggcatcgggcactgtg
ccgctcgatatcgcaccgcagggctgccagacactcactctgcttgatcaactgcctgcg
ccgcagcaccacgccgatatgtggctgacggtggaggtggttcagccgcacgcgaccgac
tggtcgcccgccgaacaccgctgcgcctgggatcaatggccgttgccgatgccgctggcg
cattcagcgccacaccgcaacgacggcgcctgtccaaccctgactcgggatgatgaccat
ttcgatatcatccacgaccagcaacgctggagcttcgaccgacgcagcggtctgctgacg
cagtggtggcgcgacgggcagccgcagctgttaagcccgctacaggacaatctgacgcgc
gcgccgctggataacgacatcggcatcagcgaagtggaccgtatcgacccgaacgcctgg
gtggaacgctggaagctggccggactgtaccagtaccagaccgactgccggcagatccgc
gccgacacgctcagcgacagcgtgctgatcaccaccgaacacgtcggtcattaccagcaa
cagacgctgttcatcagccgtaaacagtggcgtattgacgcgcaaggcgtgttgacggtc
agcgtagaggtagatgttgcccgtcacctgcctccgctggcgcgcatcggcctctacggc
caactggcggcggtcaacccacaggtaagctggctgggccttggcccgcacgaaaactac
cccgaccgccgcctcgccgcactgcacggccgctggcagcaaccgctggaggcgatgcac
acaccgtacattttcccgtcggaaaacggcctgcgctgccacacccgtgaactgcgctac
ggcgactggcttatcgagggcgatttccatttcggcatcagccgctacagcctgcaacag
ttgatggattgcacccaccagcatctgctgcagccggagccgggcacctggctcaatctc
gacggcttccacatgggcatcggcggcgacgactcctggagcccgagcgtagcgccgaac
ttcctgttgaccgccccgcgctaccgttaccagttgcaactgcggttgcaataa

DBGET integrated database retrieval system