KEGG   Dickeya dadantii 3937: Dda3937_01026Help
Entry
Dda3937_01026     CDS       T01305                                 

Gene name
glk
Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00010  Glycolysis / Gluconeogenesis
ddd00052  Galactose metabolism
ddd00500  Starch and sucrose metabolism
ddd00520  Amino sugar and nucleotide sugar metabolism
ddd00521  Streptomycin biosynthesis
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01120  Microbial metabolism in diverse environments
ddd01130  Biosynthesis of antibiotics
ddd01200  Carbon metabolism
Module
ddd_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
ddd_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_01026 (glk)
   00052 Galactose metabolism
    Dda3937_01026 (glk)
   00500 Starch and sucrose metabolism
    Dda3937_01026 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Dda3937_01026 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Dda3937_01026 (glk)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Dda3937_01026 (glk)
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Dda3937_01026 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase
Motif
Other DBs
NCBI-ProteinID: ADN00672
UniProt: E0SNC1
Position
complement(4810338..4811306)
Genome map
AA seq 322 aa AA seqDB search
MHQYALVGDVGGTNARLALCELANGHLSHSKQYAVQQHDSLEAAIRLFLAEHADLTIKEA
CIAIACPVTDDWVEMTNHHWAFSIDAMRQNLGFERLDVINDFTAVSMAIPVLTPEDVIQL
GGADAVAGKPVAVYGAGTGLGVAHLLPVNGTWLSLPGEGGHVDFAPNSEEEDILLQVLRQ
ELGHVSAERVLSGPGLVNIYRAIVKADDRVPEALTPQVVSERALAHSDVDCLRALSLFCV
LMGRFGGNLALTLGTFGGVYIAGGIVPRFLEFFRNSGFRGAFEDKGRFRDYLADIPVFMI
THPQPGLLGAGAYLRQALGQTL
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgcatcagtatgcgctggtaggtgatgtcggtggcaccaacgcacgtcttgccctttgc
gaactggcgaatgggcatctgtcacacagtaaacagtacgcggttcagcagcatgacagt
ctggaagcggcgattcgtctgtttctggcggaacacgcggatctcaccatcaaggaagcc
tgtattgccattgcctgcccggtgaccgacgactgggtggagatgaccaatcatcactgg
gcgttctccattgacgccatgcggcagaacttggggtttgagcgtctggacgtgatcaac
gattttaccgccgtcagcatggcgattccggtgctgacgccggaggatgtgattcaactg
ggcggcgccgacgcggtcgccggtaagccggtggcggtgtacggcgccggaaccgggctc
ggcgtggcgcacctgctgccggtgaacggcacgtggttaagcctgccgggcgagggcggt
cacgtggattttgcgcccaacagcgaagaagaggacattctgctacaggtattgcgtcag
gaactgggacacgtctccgccgagcgcgtgctgtccgggccggggctggtgaatatttac
cgggcgatcgtcaaagcggacgaccgggtgccggaagcgctgaccccgcaggtggtgtct
gaacgggcgctggcgcacagcgatgttgactgtttgcgcgcgctgtcgttgttttgcgtg
ctgatggggcgctttggcggcaatctggcgctgacgctcggcaccttcggcggcgtctac
atcgccggcggcatcgtgccgcgttttctggaattcttccgcaactccggttttcgcggc
gcttttgaagacaaaggccgtttccgcgactacctcgccgacattccggtgttcatgatc
acccacccgcagccggggctgctgggcgccggcgcgtacctgcgtcaggcgctcggccag
accctgtaa

DBGET integrated database retrieval system