KEGG   Dickeya dadantii 3937: Dda3937_01069Help
Entry
Dda3937_01069     CDS       T01305                                 

Definition
4-hydroxyphenylpyruvate dioxygenase
Orthology
K00457  
4-hydroxyphenylpyruvate dioxygenase [EC:1.13.11.27]
Organism
ddd  Dickeya dadantii 3937
Pathway
Ubiquinone and other terpenoid-quinone biosynthesis
Tyrosine metabolism
Phenylalanine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Amino acid metabolism
   00350 Tyrosine metabolism
    Dda3937_01069
   00360 Phenylalanine metabolism
    Dda3937_01069
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Dda3937_01069
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.27  4-hydroxyphenylpyruvate dioxygenase
     Dda3937_01069
Exosome [BR:ddd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dda3937_01069
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4860405..4861571
Genome map
AA seq 388 aa AA seqDB search
MVSHAIFIITIPSSIYLSISFKDKGNNMDELLTNPLELNGFAFIEFVTDAPETLSSLFFS
LGFTRVAHHRHRDISLFRQNDINFLVNNTAAGFPQTFLQEHGAGACGIGFYVRDAAQAYE
QALLSGARPASQTASPGEVLIPAIEGIGGSRIYFIEKYHTDIDIFDIDFTFTPDVERKPK
GFGLHTLDHLTNNVYQGRMNYWSEFYSRIFNFQQIRYFDIAGEYTGLHSKAMVAPDGKIR
IPLNEEAEGSNGQIQEFLRRFNGEGIQHIAMQTDDILTTLDRLRQAGLPLMTAPSDTYYQ
MVEERLPGHGRDIAALQTRGILIDGNTRNGQKKLLLQIFSETLIGPLFFEFIERDGDDGF
GEGNFKALFESMERDQLARGEIKATGAA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atggtctctcacgctatattcattattacaattccgtcatcgatttatttatcaatctcc
tttaaggacaaaggaaataatatggacgaattattaaccaatccgctcgaactgaatgga
ttcgctttcatcgagtttgtcaccgacgctccggaaacgctctcatcgttatttttttct
ttgggatttacacgagtggcgcaccatcgccaccgcgatatctcactcttccgacagaac
gacatcaattttcttgttaacaataccgccgccggttttccgcaaacgttcctgcaggaa
cacggcgctggcgcctgtggcatcggattttacgtcagagatgcggctcaggcttatgaa
caggcactcctgtcaggcgccaggccggcaagccaaaccgccagtccgggggaagtcctg
ataccggctatcgaaggcattggcggttcgagaatctatttcatcgagaaatatcacaca
gacatagatattttcgatatcgactttacctttactcccgacgtggaaagaaagccgaaa
ggattcgggctgcatacccttgatcatctcaccaataatgtctatcaggggagaatgaat
tactggtctgaattctatagccgaatatttaattttcagcagattcgttattttgatatt
gcaggtgaatataccggattacattctaaagccatggtggcgccggacggtaaaatccgt
attccattaaacgaagaggcggaaggcagcaacggacagattcaggaattcctgcgccgt
tttaatggcgaagggatccaacatatcgcgatgcaaaccgacgatattctgactactctc
gatcggctgcgtcaggcgggtttaccgctgatgaccgcgccatccgatacttactaccag
atggtggaggaacgtttgcccggccacggccgtgatatcgccgccctgcagacgcgcggc
attctgattgacggcaatacccgcaacgggcagaaaaaactgctgctgcaaattttctcg
gaaaccctgatcggcccgctgttttttgaattcatcgaacgggacggcgacgacggtttt
ggtgaaggcaacttcaaggcgctgtttgaatccatggagcgcgaccagctggcgcgcggg
gaaatcaaagccaccggagccgcatag

DBGET integrated database retrieval system