KEGG   Dickeya dadantii 3937: Dda3937_01221Help
Entry
Dda3937_01221     CDS       T01305                                 

Definition
3-oxoacyl-ACP synthase
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ddd  Dickeya dadantii 3937
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Dda3937_01221
  Lipid metabolism
   00061 Fatty acid biosynthesis
    Dda3937_01221
  Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    Dda3937_01221
Enzymes [BR:ddd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.179  beta-ketoacyl-[acyl-carrier-protein] synthase II
     Dda3937_01221
Lipid biosynthesis proteins [BR:ddd01004]
 Fatty acid synthase
  Component type
   Dda3937_01221
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(840311..841597)
Genome map
AA seq 428 aa AA seqDB search
MSTGNTIRIVVTGTGIVGPLGCGSETVWSRLLAGQSGIRTLPIEFTEGTGTLIGGQVPDR
QDDPLAGYDAGEVIAPKERKKMDRFIEFALMAAKEALSQAGWTPAEASQRQRTATIIASG
VGGFGAIAEAVRTTDERGPRRLSPFTAPSFLANMAAGHVSIAHGFKGPIGAPVTACAAGV
QAIGDAARLIRSGEADIALCGGTEAALHRVTLGCFAAARALSTAFNDRPQEASRPFDRDR
DGFVMAEGAGLLVIESLDHALARGARPLAELVGYGTSADAYHLTAGPEDGDGAQRAMQQA
LRQAGIAPGEVQHINAHATSTPVGDRGELSAIRAVFGTGSNVAITSTKSSTGHLLGAAGG
IEAIFTVLALRDQIVPPTLNLTHPDELANGLDLVTTSARAMPMRYALSNGFGFGGVNASV
LFRRWEAE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgggaaacactatacgtattgtcgtgacaggaaccggtatcgtcgggccgttg
gggtgtggtagcgaaactgtatggtcccgcctgctggccggacaatcaggtattcgaacg
ttacctatcgagtttaccgagggtacaggcacgttgatcggcgggcaggtgccggatcgc
caggacgatccgctggcgggttatgacgccggggaggtcattgcgcccaaagaacgcaag
aaaatggatcgtttcattgagtttgcgttaatggctgccaaagaagcgctctctcaggcg
gggtggacccctgccgaagcgtctcaacgtcagcgaacggccacgatcattgcgtccggc
gtcggcgggttcggcgccatcgccgaggcggtgcgaaccaccgacgagcgcgggccgcgc
cggctgtcgccatttaccgccccttcgttcctcgccaacatggcggccggccatgtttct
atcgcgcatggcttcaaagggccgattggcgcgccggtcaccgcttgcgcggcgggcgtg
caagctatcggcgatgcggcacggctgatacgcagcggcgaagcggacatcgctttatgc
ggcggcaccgaagcggcattacaccgcgttactctcgggtgctttgcagcggctcgggcg
ctgtcgaccgcattcaacgatcgccctcaggaagcctcacgcccctttgacagagacaga
gacggctttgtgatggccgaaggcgccgggttgctggtgatcgaatcgctcgaccacgca
ctggcgcgcggcgcgcgtccgctggcggagctggtcggctacggcaccagcgccgatgcc
taccatctgacggccggcccggaagatggcgacggcgctcaacgcgcgatgcagcaagca
ctgcgacaagccggcatcgctcccggcgaggttcagcacatcaacgcacatgctacctct
acgccagtcggcgatcggggagagctgagcgccattcgtgctgtgttcggaaccggctcc
aacgtcgcgatcacctcaaccaaatccagtaccggtcatttactgggagcggccggcggc
atcgaggccattttcacggttctggcgttgcgcgatcaaatcgtgcccccgactctcaac
ctgacccatccggatgagctggccaacggccttgatctggtaacgacatccgcacgggca
atgccgatgcgatatgccctgtcgaatgggtttgggttcggcggagtgaacgccagcgtg
ctgttccgtcgctgggaagcggagtaa

DBGET integrated database retrieval system