KEGG   Dickeya dadantii 3937: Dda3937_01221Help
Entry
Dda3937_01221     CDS       T01305                                 

Definition
3-oxoacyl-ACP synthase
Orthology
K09458  
3-oxoacyl-[acyl-carrier-protein] synthase II [EC:2.3.1.179]
Organism
ddd  Dickeya dadantii 3937
Pathway
Fatty acid biosynthesis
Biotin metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, elongation
Pimeloyl-ACP biosynthesis, BioC-BioH pathway, malonyl-ACP => pimeloyl-ACP
Class
Metabolism; Overview; Fatty acid metabolism [PATH:ddd01212]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:ddd00061]
Metabolism; Metabolism of cofactors and vitamins; Biotin metabolism [PATH:ddd00780]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(840311..841597)
Genome map
AA seq 428 aa AA seqDB search
MSTGNTIRIVVTGTGIVGPLGCGSETVWSRLLAGQSGIRTLPIEFTEGTGTLIGGQVPDR
QDDPLAGYDAGEVIAPKERKKMDRFIEFALMAAKEALSQAGWTPAEASQRQRTATIIASG
VGGFGAIAEAVRTTDERGPRRLSPFTAPSFLANMAAGHVSIAHGFKGPIGAPVTACAAGV
QAIGDAARLIRSGEADIALCGGTEAALHRVTLGCFAAARALSTAFNDRPQEASRPFDRDR
DGFVMAEGAGLLVIESLDHALARGARPLAELVGYGTSADAYHLTAGPEDGDGAQRAMQQA
LRQAGIAPGEVQHINAHATSTPVGDRGELSAIRAVFGTGSNVAITSTKSSTGHLLGAAGG
IEAIFTVLALRDQIVPPTLNLTHPDELANGLDLVTTSARAMPMRYALSNGFGFGGVNASV
LFRRWEAE
NT seq 1287 nt NT seq  +upstreamnt  +downstreamnt
atgagtacgggaaacactatacgtattgtcgtgacaggaaccggtatcgtcgggccgttg
gggtgtggtagcgaaactgtatggtcccgcctgctggccggacaatcaggtattcgaacg
ttacctatcgagtttaccgagggtacaggcacgttgatcggcgggcaggtgccggatcgc
caggacgatccgctggcgggttatgacgccggggaggtcattgcgcccaaagaacgcaag
aaaatggatcgtttcattgagtttgcgttaatggctgccaaagaagcgctctctcaggcg
gggtggacccctgccgaagcgtctcaacgtcagcgaacggccacgatcattgcgtccggc
gtcggcgggttcggcgccatcgccgaggcggtgcgaaccaccgacgagcgcgggccgcgc
cggctgtcgccatttaccgccccttcgttcctcgccaacatggcggccggccatgtttct
atcgcgcatggcttcaaagggccgattggcgcgccggtcaccgcttgcgcggcgggcgtg
caagctatcggcgatgcggcacggctgatacgcagcggcgaagcggacatcgctttatgc
ggcggcaccgaagcggcattacaccgcgttactctcgggtgctttgcagcggctcgggcg
ctgtcgaccgcattcaacgatcgccctcaggaagcctcacgcccctttgacagagacaga
gacggctttgtgatggccgaaggcgccgggttgctggtgatcgaatcgctcgaccacgca
ctggcgcgcggcgcgcgtccgctggcggagctggtcggctacggcaccagcgccgatgcc
taccatctgacggccggcccggaagatggcgacggcgctcaacgcgcgatgcagcaagca
ctgcgacaagccggcatcgctcccggcgaggttcagcacatcaacgcacatgctacctct
acgccagtcggcgatcggggagagctgagcgccattcgtgctgtgttcggaaccggctcc
aacgtcgcgatcacctcaaccaaatccagtaccggtcatttactgggagcggccggcggc
atcgaggccattttcacggttctggcgttgcgcgatcaaatcgtgcccccgactctcaac
ctgacccatccggatgagctggccaacggccttgatctggtaacgacatccgcacgggca
atgccgatgcgatatgccctgtcgaatgggtttgggttcggcggagtgaacgccagcgtg
ctgttccgtcgctgggaagcggagtaa

DBGET integrated database retrieval system