KEGG   Dickeya dadantii 3937: Dda3937_01340Help
Entry
Dda3937_01340     CDS       T01305                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dda3937_01340
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Dda3937_01340
Exosome [BR:ddd04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Dda3937_01340
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
487113..488624
Genome map
AA seq 503 aa AA seqDB search
MSRDLIVALDEGTSNVKAVAIDAGGRVLARASRPLGLITPRAGWVEQDGEALLAGSFAVV
REVMEQVGAERVAALAVSNQRETAIGWQRDTGRPLSAALSWQCSRSAPFCEQLRRDQQEA
AIRAATGLPVAPLFSGSKMRWLLDNTPDGHARAARGEICLGTIDAWLLWHLTGGRQFRCD
LSNAARTQLLNLHRLQWDDAMLALFGIPRAALPELMPSAGEFGVTCGVPGVADGIPILAM
AGDSHAALYGHGLGRLGGVKATYGTGSSVMAPLGAPDTRITTLATTVAWHDGERAVYALE
GNIPHTGDGVAWMLQATGLNRLPEAELAGALQTLPAGIDSTDGVYFVPALTGAGAPWWND
RARGVMCGLSRGSGQAHLVRAALEAIAYQIADVVAAMRQHPDFHLDRLMVDGGPTRNAWL
MQFQADLLGCPVARSTTTELSALGAGLLARRVLGSLDDEQLARLLPTHDSWLPDDARHQR
YQANWQGWQAAVRRTLWQADLNG
NT seq 1512 nt NT seq  +upstreamnt  +downstreamnt
atgtctagagacctgatcgtcgcgctggacgagggcaccagcaacgtcaaggcggtggcg
atcgacgccggcggccgggtgctggcccgcgcctcccgaccgctcggcctgatcaccccg
cgcgccggctgggtggagcaggatggcgaggcgctgctggccgggtctttcgcggtggtg
cgcgaggtgatggaacaagtgggcgccgaacgcgtcgcggcgctggcggtcagcaatcag
cgcgagacggcgatcggctggcaacgcgacaccggtcggccgctttccgcggcgctaagc
tggcagtgctcccgctcggcgccgttttgcgagcagctacggcgcgaccagcaggaagcg
gcgatccgcgcggcgaccgggctgccggtggcgccgttgttctccggctccaaaatgcgc
tggctgctggacaacacgccggacggccatgcccgcgcggcgcgcggcgaaatttgcctc
ggtaccatcgacgcctggctgctgtggcacctcaccggcgggcggcagttccgctgcgat
ctttccaacgccgctcgcacccagttgcttaatctgcaccgtttgcagtgggatgacgcg
atgctggcgctgttcggcatcccgcgtgcggcgctgccggaactgatgccctcggccggc
gagtttggcgtcacctgcggcgtgcccggcgtggcggacggcatcccgattctggcgatg
gcgggggattcccacgccgcgctgtacggtcacggactgggacggttgggtggggtgaaa
gccacctacggcaccgggtcgtcggtgatggcgccgctgggtgcgccggatacgcgcatc
accacgctggcgaccaccgtcgcctggcacgacggcgagcgggcggtgtacgcgctggag
ggcaacattccccacaccggcgacggcgtggcctggatgctacaggccaccggcctcaac
cggttgccggaggcggagcttgccggggcgttgcagacgctgcccgccggcatcgattct
accgacggggtgtatttcgtgccggcgctgaccggcgcgggcgcgccctggtggaacgat
cgggcgcgcggggtgatgtgcggcctgagtcgcggcagcgggcaggcgcatctggtgcgg
gcggcgctggaggcgatcgcctaccagatagccgatgtggtggcggcgatgcggcagcat
ccggattttcatctggatcggctgatggtggacggcgggccgacccgcaacgcctggctg
atgcaatttcaggctgacttgctgggctgtccggtggcgcgcagcaccaccaccgagctg
tcggcgttgggggccgggctgctggcgcgccgcgtgctcggctcgctggacgatgaacaa
ctggcgcggctgttgccgacgcacgatagctggctgccggacgacgcgcgccatcagcgt
tatcaggcgaactggcaagggtggcaggcggcggtccggcgcacgctgtggcaggcggat
ctcaatgggtaa

  All links  
No link information was found.   
DBGET integrated database retrieval system