KEGG   Dickeya dadantii 3937: Dda3937_01534Help
Entry
Dda3937_01534     CDS       T01305                                 

Gene name
sucB
Definition
dihydrolipoyltranssuccinase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ddd  Dickeya dadantii 3937
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Class
Metabolism; Overview; Carbon metabolism [PATH:ddd01200]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ddd00020]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ddd00310]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1444980..1446206
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDSVQRDEVLVEIETDKVVLEVPALEAGVLEVV
LEAEGATVTSRQVLGRLRPGDNSGKETSEKAQSKESTPAQRHTAGLEDENNDALSPAIRR
LIAEHDLDAAAIKGSGVGGRITREDVEKHLAGQKPAGKKADAPAAAPASPAPALGSRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEINMKPIMDLRKQYGEAFEKRHGIRLGFMSF
YIKAVVEALKRYPEVNASIDGEDVVYHNYFDVSIAVSTPRGLVTPVLKDVDLLGMAEIEK
RIKELAVKGRDGKLTVEELTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VDGQVVILPMMYLALSYDHRLVDGRESVGFLVTVKEMLEDPARLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattcttgtccctgacctgcctgaatcggtagccgacgcgactgtg
gctacctggcacaagaaaccgggcgacagtgtccagcgtgatgaagtgctggttgagatt
gaaaccgacaaagtcgtgctggaagttcctgcgctggaagccggcgtgttggaagtggtg
ctggaagccgaaggcgccaccgtaacgtcccgtcaggttctggggcgtttgcgtcccggc
gacaattctggcaaggaaaccagcgaaaaagcgcagagcaaagagtcgacgcccgcacag
cgccacactgccggactggaagatgagaataacgatgccctgagtccggctatccgtcgt
ctgattgccgagcacgatctggacgcggctgccatcaagggcagcggcgttggcggccgt
atcactcgtgaagacgtggaaaaacacctggctggtcagaaaccggctggcaaaaaagcg
gatgcgcctgccgcagcgccggcctcacctgcgccggcattgggcagccgcagcgagaaa
cgtgttcccatgacccgtctgcgcaagcgcgtggccgaacgtctgctggaagccaaaaac
agcaccgccatgctgaccacgttcaacgaaatcaacatgaaaccgatcatggacctgcgc
aagcagtatggtgaggcgttcgagaaacgtcacggcattcgtctgggcttcatgtccttc
tatatcaaggccgtggtggaggcgctgaaacgctatccggaagtgaatgcgtccattgat
ggcgaagacgtggtttaccacaattactttgatgtcagcatcgcggtgtcgactcctcgc
ggcctggtgacgcctgtgttgaaagatgtcgatctgctgggcatggccgagatcgagaag
agaatcaaagaactggcagtgaaaggccgtgacggcaaactgaccgtcgaagagctgacc
ggaggtaacttcaccatcaccaacggcggcgtgttcggttccctgatgtcgacgccgatc
atcaacccgccgcagagcgcgattctggggatgcacgccatcaaggatcgcccgatggcg
gtggatggtcaggttgtgattctgccgatgatgtatctggcgttgtcctacgatcaccgt
ctggtcgacggccgtgagtcggtcggtttcctggtgaccgttaaagagatgctggaagac
ccggcccgcttgctgctggatgtctaa

DBGET integrated database retrieval system