KEGG   Dickeya dadantii 3937: Dda3937_01538Help
Entry
Dda3937_01538     CDS       T01305                                 

Gene name
sdhD
Definition
(GenBank) succinate dehydrogenase, membrane subunit, binds cytochrome b556
  KO
K00242  succinate dehydrogenase / fumarate reductase, membrane anchor subunit
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00020  Citrate cycle (TCA cycle)
ddd00190  Oxidative phosphorylation
ddd00650  Butanoate metabolism
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01120  Microbial metabolism in diverse environments
ddd01130  Biosynthesis of antibiotics
ddd01200  Carbon metabolism
Module
ddd_M00009  Citrate cycle (TCA cycle, Krebs cycle)
ddd_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
ddd_M00149  Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dda3937_01538 (sdhD)
   00650 Butanoate metabolism
    Dda3937_01538 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Dda3937_01538 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Sdh_cyt CybS
Motif
Other DBs
NCBI-ProteinID: ADM97553
UniProt: E0SEZ1
Position
1439063..1439410
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVIVLYVLYIVGFVASAGNITYEVWRGFFAMHLTKVF
TLLTLFAILVHAWIGMWQVLTDYIKPLAVRLTLQLAIVVALLVYVIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcctccgcattggggcgtaatggcgtacacgattggttattacttcgc
gcttccgccatcgtcatcgtgctgtatgttctctatatcgttggctttgtggccagcgcc
ggtaacatcacgtatgaagtctggcgaggtttcttcgccatgcatctcaccaaggtgttc
accctgctgacgttgttcgccattctggtccatgcctggatcgggatgtggcaggtgctg
actgattacatcaaaccgcttgccgtccggctgactttacagctggctatcgtggtcgcg
ttgttggtgtacgtcatttatggaactgttgtggtgtggggtgcgtaa

DBGET integrated database retrieval system