KEGG   Dickeya dadantii 3937: Dda3937_01538Help
Entry
Dda3937_01538     CDS       T01305                                 

Gene name
sdhD
Definition
succinate dehydrogenase, membrane subunit, binds cytochrome b556
Orthology
K00242  
succinate dehydrogenase membrane anchor subunit
Organism
ddd  Dickeya dadantii 3937
Pathway
Citrate cycle (TCA cycle)
Oxidative phosphorylation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Succinate dehydrogenase, prokaryotes
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dda3937_01538 (sdhD)
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Dda3937_01538 (sdhD)
   00650 Butanoate metabolism
    Dda3937_01538 (sdhD)
  Energy metabolism
   00190 Oxidative phosphorylation
    Dda3937_01538 (sdhD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1439063..1439410
Genome map
AA seq 115 aa AA seqDB search
MVSNASALGRNGVHDWLLLRASAIVIVLYVLYIVGFVASAGNITYEVWRGFFAMHLTKVF
TLLTLFAILVHAWIGMWQVLTDYIKPLAVRLTLQLAIVVALLVYVIYGTVVVWGA
NT seq 348 nt NT seq  +upstreamnt  +downstreamnt
atggtaagcaatgcctccgcattggggcgtaatggcgtacacgattggttattacttcgc
gcttccgccatcgtcatcgtgctgtatgttctctatatcgttggctttgtggccagcgcc
ggtaacatcacgtatgaagtctggcgaggtttcttcgccatgcatctcaccaaggtgttc
accctgctgacgttgttcgccattctggtccatgcctggatcgggatgtggcaggtgctg
actgattacatcaaaccgcttgccgtccggctgactttacagctggctatcgtggtcgcg
ttgttggtgtacgtcatttatggaactgttgtggtgtggggtgcgtaa

DBGET integrated database retrieval system