KEGG   Dickeya dadantii 3937: Dda3937_01621Help
Entry
Dda3937_01621     CDS       T01305                                 

Gene name
ruvA
Definition
RuvABC resolvasome regulatory subunit
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ddd  Dickeya dadantii 3937
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dda3937_01621 (ruvA)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     Dda3937_01621 (ruvA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2273821..2274438
Genome map
AA seq 205 aa AA seqDB search
MIGRLRGIVLEKQPPLVLIEASGVGYEVHMPMTCFYELPDLGQEAVIFTHFVVREDAQLL
FGFNNKQERSLFRELIKVNGVGPKLALAILSGMSAQQFVSAVERQEINALVKLPGVGKKT
AERLVVEMKDRFKGLNGDLFNAASDIALPEAAGKAEPEADPQAEAEAALVALGYKPQEAG
RMVSKVARPGADCETLIREALRAAL
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
gtgataggtcgtctcagaggcatcgtactggaaaaacagccgccactggttctgattgaa
gccagcggcgtcggatatgaagttcatatgccgatgacctgcttttacgagttgccggat
ctcggccaggaagcggtgatttttacccactttgtagtgcgtgaagatgctcaattactg
tttggcttcaacaacaaacaagagcgttcgctgttccgtgaactgatcaaagtgaacggc
gtggggccgaaactggcgttggcgattttgtccggcatgtcggcccaacagttcgtcagc
gcggtggagcgtcaggaaatcaacgcgctggtaaaattaccgggcgtgggcaagaaaacg
gcggagcgtttggtcgtagaaatgaaagaccgctttaaagggttgaacggcgatctgttc
aacgccgccagcgatattgccttgccggaagcggctggcaaggcggaaccagaggcggat
ccgcaggctgaagccgaagcggcgctggtcgccctcggttataaaccgcaggaggccggc
cggatggtgagcaaagtggcgcggccgggggccgactgcgaaaccctgatcagggaagcg
ctgcgcgctgcgctgtga

DBGET integrated database retrieval system