KEGG   Dickeya dadantii 3937: Dda3937_01790Help
Entry
Dda3937_01790     CDS       T01305                                 

Gene name
tesA
Definition
multifunctional acyl-CoA thioesterase I/protease I/lysophospholipase L1
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
ddd  Dickeya dadantii 3937
Pathway
Biosynthesis of unsaturated fatty acids
Class
Metabolism; Lipid metabolism; Biosynthesis of unsaturated fatty acids [PATH:ddd01040]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1341640..1342281)
Genome map
AA seq 213 aa AA seqDB search
MMNFKNVFRWHVVVLLFWGLFSLRAFAADTLLVLGDSLSAGYRMAANQAWPSLLDATWQS
SSPAPKVRVVNASISGDTATQGLARLSTLLQQHQPRWVLIELGGNDGLRGFPPQNVERDL
ASIITQVKTANAQPLLMQIRLPANYGRRYTESFSAVYPRLAKTFDIPLLPFFMEQVYLKP
EWMQDDGIHPNRDAQPFIAGWMAKQLEPVVNQH
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacttcaagaatgttttccgctggcatgtcgttgtccttctattttggggcctg
ttcagtctgcgcgccttcgcggcggatacgttgttggtactgggcgacagcctgagtgcc
ggctatcgtatggcggcgaatcaggcctggccttcgctgctggacgcgacctggcagtcc
agctctcccgcgcccaaggtccgggtggtgaacgccagtatcagcggcgacacggcaacg
caggggctggcgcgtctgtcgacattgctgcaacagcaccagccgcgctgggtgttgatc
gagctgggcggcaatgacgggctgcgtggtttccccccgcagaacgtagagcgggatctc
gccagcatcattacccaggtcaagacggccaacgcccaaccgctgctgatgcaaatccgc
ttgccagccaactacgggcgacgctataccgaatcgttcagtgctgtttatccgcgcctc
gccaaaacgtttgatattccgttgctgccgtttttcatggagcaggtttatctcaaaccg
gaatggatgcaggatgatggcatccatcccaatcgcgatgcccagccgtttatcgccgga
tggatggcaaaacagctcgaacccgttgttaatcagcactaa

DBGET integrated database retrieval system