KEGG   Dickeya dadantii 3937: Dda3937_01994Help
Entry
Dda3937_01994     CDS       T01305                                 

Gene name
celY
Definition
(GenBank) endoglucanase Y
  KO
K20542  
endoglucanase [EC:3.2.1.4]
Organism
ddd  Dickeya dadantii 3937
Brite
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Dda3937_01994 (celY)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
131069..132067
Genome map
AA seq 332 aa AA seqDB search
MGKPMWRCWALMLMVWFSASATAANGWEIYKSRFMTTDGRIQDTGNKNVSHTEGQGFAML
MAVHYDDRIAFDNLWNWTQSHLRNTTSGLFYWRYDPSAANPVVDKNNASDGDVLIAWALL
KAGNKWQDNRYLQASDSIQKAIIASNIIQFAGRTVMLPGAYGFNKNSYVILNPSYFLFPA
WRDFANRSHLQVWRQLIDDSLSLVGEMRFGQVGLPTDWAALNADGSMAPATAWPSRFSYD
AIRIPLYLYWYDAKTTALVPFQLYWRNYPRLTTPAWVDVLSSNTATYNMQGGLLAVRDLT
MGNLDGLSDLPGASEDYYSSSLRLLVMLARGK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagccaatgtggcgttgttgggcgttgatgctgatggtgtggttcagtgcgtcg
gctacggcggcgaacggctgggaaatctataaaagccgtttcatgaccacggacgggcgc
attcaggataccggcaataagaatgtcagccacaccgaaggtcagggattcgccatgctg
atggcggtgcattacgatgaccgcatcgcgttcgataacctgtggaactggacgcaaagc
cacctgcggaacacgaccagcggcttgttctactggcgttacgatccgtcggcggccaat
ccggtggtggataagaacaacgcctcggatggcgatgtgctgattgcctgggcgttgtta
aaagcgggaaataagtggcaggacaaccgttacctgcaggcgtcggacagcatccagaaa
gcgatcatcgccagcaatatcattcagtttgcgggccgcaccgtgatgttgcccggcgcc
tatggtttcaacaagaacagctatgtgatccttaacccgtcgtatttcctgttcccggcc
tggcgcgactttgctaaccgcagccatcttcaggtgtggcggcaactgattgacgacagc
ctgtcattggtcggagaaatgcgtttcggtcaggtcgggctgccgacggactgggcggcg
ctgaacgcggatggctcgatggcgccggcgacggcctggccgtcgcgtttcagttacgac
gccattcgtatcccgctgtatttgtactggtatgacgccaaaaccacggcgctggtgccg
ttccagctgtactggcgtaactatccccgcctgacgacgccggcctgggttgatgtgctg
agcagtaacaccgcgacttacaatatgcagggcggtttgctggcggtgcgcgacctgacg
atgggcaacctcgacgggctcagcgatctgccaggcgcatcggaagattactactcgtcg
agcctgcgcctgctggtgatgttggcgcgcggtaaataa

DBGET integrated database retrieval system