KEGG   Dickeya dadantii 3937: Dda3937_01994Help
Entry
Dda3937_01994     CDS       T01305                                 

Gene name
celY
Definition
endoglucanase Y
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddd  Dickeya dadantii 3937
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
131069..132067
Genome map
AA seq 332 aa AA seqDB search
MGKPMWRCWALMLMVWFSASATAANGWEIYKSRFMTTDGRIQDTGNKNVSHTEGQGFAML
MAVHYDDRIAFDNLWNWTQSHLRNTTSGLFYWRYDPSAANPVVDKNNASDGDVLIAWALL
KAGNKWQDNRYLQASDSIQKAIIASNIIQFAGRTVMLPGAYGFNKNSYVILNPSYFLFPA
WRDFANRSHLQVWRQLIDDSLSLVGEMRFGQVGLPTDWAALNADGSMAPATAWPSRFSYD
AIRIPLYLYWYDAKTTALVPFQLYWRNYPRLTTPAWVDVLSSNTATYNMQGGLLAVRDLT
MGNLDGLSDLPGASEDYYSSSLRLLVMLARGK
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgggaaagccaatgtggcgttgttgggcgttgatgctgatggtgtggttcagtgcgtcg
gctacggcggcgaacggctgggaaatctataaaagccgtttcatgaccacggacgggcgc
attcaggataccggcaataagaatgtcagccacaccgaaggtcagggattcgccatgctg
atggcggtgcattacgatgaccgcatcgcgttcgataacctgtggaactggacgcaaagc
cacctgcggaacacgaccagcggcttgttctactggcgttacgatccgtcggcggccaat
ccggtggtggataagaacaacgcctcggatggcgatgtgctgattgcctgggcgttgtta
aaagcgggaaataagtggcaggacaaccgttacctgcaggcgtcggacagcatccagaaa
gcgatcatcgccagcaatatcattcagtttgcgggccgcaccgtgatgttgcccggcgcc
tatggtttcaacaagaacagctatgtgatccttaacccgtcgtatttcctgttcccggcc
tggcgcgactttgctaaccgcagccatcttcaggtgtggcggcaactgattgacgacagc
ctgtcattggtcggagaaatgcgtttcggtcaggtcgggctgccgacggactgggcggcg
ctgaacgcggatggctcgatggcgccggcgacggcctggccgtcgcgtttcagttacgac
gccattcgtatcccgctgtatttgtactggtatgacgccaaaaccacggcgctggtgccg
ttccagctgtactggcgtaactatccccgcctgacgacgccggcctgggttgatgtgctg
agcagtaacaccgcgacttacaatatgcagggcggtttgctggcggtgcgcgacctgacg
atgggcaacctcgacgggctcagcgatctgccaggcgcatcggaagattactactcgtcg
agcctgcgcctgctggtgatgttggcgcgcggtaaataa

DBGET integrated database retrieval system