KEGG   Dickeya dadantii 3937: Dda3937_02069Help
Entry
Dda3937_02069     CDS       T01305                                 

Definition
porphobilinogen synthase
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ddd  Dickeya dadantii 3937
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ddd00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4622520..4623542)
Genome map
AA seq 340 aa AA seqDB search
MSHAFPGTFPGRRMRRLRRHDFSRRLVAEHQVTVNDLIYPVFVMEGKQGRQEVPSMPGVY
RLTIDELVREAEIIAKLGIPVLSLFPVIGADKKSLLAEEAYNPDGLVQRTVRALKDAVPE
LGLLTDVALDPYTTHGQDGVIDEDGYVVNDITKEILVRQALSHAEAGAEIVAPSDMMDGR
IGAIRDRLEEQGLVNTQIMAYSAKYASCYYGPFRDALGSSGNLKGGNKKTYQMDPANTNE
ALQEIAQDLQEGADMVMVKPGMPYLDVVRRVKDTFGVPTFAYQVSGEYAMQMAAIQNGWL
QEQPLVMESLLCFKRAGADGVLTYFAKRVAEWLRDEALRR
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgagtcatgcttttcccggtacgtttcccggacggcgtatgcgtcgcctgcgccgtcat
gatttcagccgccgtctggtggcggagcatcaggtcacggttaacgacctcatctacccg
gtatttgtcatggaaggcaagcagggacgtcaggaagtgccctctatgccgggcgtgtat
cgtctgacgatcgatgagctggtcagggaagcggaaatcatcgctaaattaggtattccg
gtgctgtcgttgttcccggtgattggagcagacaaaaagtcgctgctggccgaggaagcc
tacaacccggacgggctggtgcaacgcaccgtgcgcgcgttgaaagacgcggtgccggag
ctggggctgctgaccgatgtggcgctggacccttacaccacgcacggtcaggacggtgtg
atcgatgaagacggttatgtggtcaatgacatcaccaaagagattctggtgcgtcaggcg
ttgtcccacgccgaagccggcgctgagatcgtcgcgcccagcgacatgatggacggccgc
atcggcgctatccgcgaccgactggaagaacaggggctggtgaacacccagatcatggcg
tattcagccaagtatgcgtcctgttactacgggccgtttcgtgatgcgctcggctcgtcg
ggtaacctgaaaggcggcaacaagaaaacctatcagatggatccggccaacaccaatgag
gcgttgcaggagatcgcgcaggatctgcaggaaggcgccgacatggtgatggtgaaaccg
gggatgccgtatctggatgtggtacgccgcgtgaaggacacctttggcgtaccgaccttc
gcctatcaggtgtccggtgaatacgcgatgcagatggcggcgatccagaatggctggctg
caggaacagccgctggtgatggagtcgttgctgtgcttcaaacgcgccggggcggatggg
gtgctgacctatttcgccaaacgcgtggccgaatggctgcgggatgaggcgttacgtcgc
tga

DBGET integrated database retrieval system