KEGG   Dickeya dadantii 3937: Dda3937_02077Help
Entry
Dda3937_02077     CDS       T01305                                 

Gene name
fadB
Definition
enoyl-CoA hydratase/Delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase/3-hydroxyacyl-CoA dehydrogenase/3-hydroxybutyryl-CoA epimerase
Orthology
K01825  
3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
ddd  Dickeya dadantii 3937
Pathway
Fatty acid degradation
Valine, leucine and isoleucine degradation
Geraniol degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Limonene and pinene degradation
Caprolactam degradation
Biosynthesis of unsaturated fatty acids
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Fatty acid metabolism
Module
beta-Oxidation
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dda3937_02077 (fadB)
   01212 Fatty acid metabolism
    Dda3937_02077 (fadB)
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Dda3937_02077 (fadB)
   00650 Butanoate metabolism
    Dda3937_02077 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    Dda3937_02077 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    Dda3937_02077 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Dda3937_02077 (fadB)
   00310 Lysine degradation
    Dda3937_02077 (fadB)
   00380 Tryptophan metabolism
    Dda3937_02077 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Dda3937_02077 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Dda3937_02077 (fadB)
   00281 Geraniol degradation
    Dda3937_02077 (fadB)
  Xenobiotics biodegradation and metabolism
   00930 Caprolactam degradation
    Dda3937_02077 (fadB)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Dda3937_02077 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Dda3937_02077 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Dda3937_02077 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  dodecenoyl-CoA isomerase
     Dda3937_02077 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4612994..4615183
Genome map
AA seq 729 aa AA seqDB search
MIYQGDTLYLNWLENGIAELVFAAPGSVNKLDTRTVASLGEALNHLKNQPSLRALLLRSD
KPAFIAGADITEFLSLFAAPPETLHQWLTEANAIFSQLEDLPVPTLSAINGYALGGGCEC
ALATDFRIATPDVRIGLPEVKLGIMPGFGGTVRLPRLLGADGALEIITAGKDLPAGEALK
VGLVDAVLDSDKLLPAALHMLRLAITDQLDWRDRRRQKQSPLRLNRIEAAMSFATANALV
QQAAGRHYPAPVMALKTIEAAAGLHRDAALKIETDNFVALTQTTAAHALVGVFLNEQAVK
SAAKQWAADASPPARVAVLGAGIMGGGIACQSARKGVPVWMKDISEKALTLGMEEAAKLL
NAQLERGKLDAMTMAGVLARIHPTLNNNGLEQADLIIEAVVENPQVKARVLAEAEACVSE
QTLIVSNTSTIPIGQLAVSLQRPQNFCGMHFFNPVHRMPLVEVIRGPQTDEKTLARVVAY
ASKIGKTPIVVNDCPGFFVNRVLFPYIAAFNLLMRDGADFRDVDTVMEKQFGWPMGPAYL
LDVVGLDTAHHAQAVMSAGFPQRMAKTYRDAVDVLVEHQRFGQKSGAGFYRYYPDAKGKP
HREQDEQTDILLDAVCEPKRTFSAQEIIHRLMVPMLNEVARCLEEGIVATPAEADMALLY
GLGFPPFHGGACRYLDTLGSQRYVDIAQSLASLGPLYAVPDSLLQMAQRRQRYYPAVEPH
ANLSLHQPA
NT seq 2190 nt NT seq  +upstreamnt  +downstreamnt
atgatctatcaaggcgacacgctgtacctcaactggctggaaaacggcattgccgaactg
gtttttgccgcgcccggcagcgttaataaattggatacccgcactgtagccagccttggc
gaggcgctaaaccatctgaagaaccaaccgtcactacgcgccctgctgttgcgctcggat
aaaccggctttcatcgccggtgcggatatcaccgaattcctgtcgctgtttgccgccccg
ccggaaacgttgcatcaatggctgaccgaagccaacgccattttcagccaactggaggat
ttgccggtcccgacgctctccgccatcaacggctatgcgctgggcgggggatgtgaatgc
gcgctggcgaccgacttccgcattgcgacgcctgacgttcgcatcggtctgccggaagtc
aaactggggatcatgccgggattcggcggcacagtccggctgccgcggttgctgggcgcg
gacggcgcgctggaaatcatcaccgccggtaaagacttgcccgccggcgaggccctgaaa
gtcgggctggttgacgccgtcctggacagcgacaaactgctgcccgccgccctgcatatg
ttgcgtctggcaataaccgaccaactcgactggcgtgaccgtcgccgccagaaacagtcg
ccgctacggcttaaccgtatcgaagccgccatgagtttcgccaccgccaacgcgctggtg
caacaggcggcgggccgccactaccccgcgccggtgatggcgctcaaaaccatcgaagcc
gccgccgggctgcaccgcgacgccgcactaaaaatcgaaaccgacaatttcgtcgcgctg
actcaaacgacggcggcgcatgcgctggtcggcgtcttccttaacgagcaggccgtaaaa
agcgccgccaaacaatgggccgccgacgcctcgccgccggcacgtgtcgcggtgctgggc
gccgggatcatgggcggcggcatcgcctgccagtcggcacgcaaaggggtgccggtgtgg
atgaaagacatcagtgaaaaagcgctgacactggggatggaagaagcggctaagctgctt
aacgcacagttggaacgcggcaaactggacgccatgactatggcgggggtgctggcccgc
atccacccgacactgaacaataacgggcttgaacaggccgacctgattatcgaagcggtg
gtggaaaacccgcaggtaaaagccagggtgctggcagaggcggaagcctgcgtcagcgag
cagacgctgatcgtctccaatacctcgacgattcccatcgggcagttagcggtctcattg
cagcggccgcaaaacttctgcggtatgcactttttcaatccggtgcatcgtatgccgctg
gttgaagtgattcgcggtccccagaccgatgaaaaaacgctggcccgcgtagtggcttac
gccagcaagatcggcaaaaccccgatcgtggtgaatgactgcccggggtttttcgtcaac
cgcgtactgttcccctacatcgccgccttcaacctgctgatgcgcgacggcgcggatttc
cgcgatgtggacacggtgatggagaagcagttcggctggccgatggggccggcttacctg
ttggacgtagtcggactggataccgctcatcacgctcaggcggtgatgtcggcaggcttt
ccgcagcgcatggcgaaaacctaccgcgacgccgtcgatgtgctggtggagcatcagcgt
ttcggccagaagagcggcgcgggcttctaccgctactatccggatgccaaaggcaaaccg
caccgggaacaggatgagcaaaccgatatcttgctggatgcggtctgcgaaccgaagcga
accttcagcgcgcaagagattatccatcgcctgatggtgccgatgctcaacgaagtggcg
cgctgtctggaagaaggcatcgtcgctaccccggcggaagccgacatggctctgctgtac
ggtctgggcttcccgccgttccacggcggcgcctgccgctatctggatacgctgggcagc
caacgctatgtggacatcgcccagtcgctggcgtcgctggggccgctctacgccgtgccg
gacagcctgttgcagatggcgcagcgccggcagcgctattacccggcggttgaacctcac
gccaatctttctcttcaccaaccggcataa

DBGET integrated database retrieval system