KEGG   Dickeya dadantii 3937: Dda3937_02127Help
Entry
Dda3937_02127     CDS       T01305                                 

Gene name
aceB
Definition
(RefSeq) malate synthase A
  KO
K01638  
malate synthase [EC:2.3.3.9]
Organism
ddd  Dickeya dadantii 3937
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Dda3937_02127 (aceB)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Dda3937_02127 (aceB)
   00630 Glyoxylate and dicarboxylate metabolism
    Dda3937_02127 (aceB)
Enzymes [BR:ddd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Dda3937_02127 (aceB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4359315..4360913)
Genome map
AA seq 532 aa AA seqDB search
MTQQTISRELAFTAVFGEEERQILTAEAVDFLTMLVSRFTPQRNRLLAERQAAQARIDNG
ELPNFISETNSIRSADWKVRGIPADLLDRRVEITGPVERKMVINALNANVKVFMADFEDS
LAPSWSKVIEGQINLRDAVRGTITYTSETGKIYQLKPDPAVLICRVRGLHLPEKHVLWRD
EPIPGSLFDFALYFFHNYRQLLAKGSGPYFYLPKTQSWQEAAWWGEVFSYTEDHFGLTRG
TIKATILIETLPAVFQMDEILYHLRDHIVGLNCGRWDYIFSYIKTLKNHPDRVLPDRQSV
TMDKPFLNAYSRLLIKTCHRRGAFAMGGMAASIPSKDVERNAWVQEKVRQDKELEARNGH
DGTWIAHPGLADTVMPVFDRLLGDRPNQLDMLREDDAPVTADELLAPCPGERTEAGMRAN
IRVAVQYIEAWISGNGCVPIYGLMEDAATAEISRTSIWQWIHHGKTLSDGRVVTKALFRQ
MLAEEMQVIRVELGDARFDGGRFEEAARLMERITTQDALIDFLTLPGYDLLD
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgacacaacagacgataagcagggaattggcgtttaccgccgtatttggcgaggaagaa
cggcagattttgacggcagaggcggtggattttctcacgatgctggtcagccggttcacc
ccgcagcgtaaccgcttactggcggaacgtcaggcggcacaggcgcgcattgataacgga
gaattacccaattttatttcggaaacgaattccataaggagtgccgactggaaggtgcgt
ggcattccagccgatctgctggatcgccgggtagagattaccggcccggtggaacgaaaa
atggtgattaatgccctgaatgccaacgtgaaagtctttatggcggactttgaagattca
ctggcgcccagttggtcgaaagtgattgaggggcaaatcaacttgcgggatgcggtacgc
ggcaccatcacttataccagcgagacgggaaagatttatcagctcaaacccgacccggcg
gtgttgatctgccgggtacgcggtctgcacctgccggaaaaacacgtgttgtggcgcgat
gagcctatccccggcagcctgttcgatttcgcactctattttttccacaactaccgtcaa
ctgctggcaaaaggcagcggcccctatttctacctgccgaaaacccagtcctggcaggaa
gccgcctggtggggtgaggtattcagttacaccgaggaccattttggcctgacgcgcggc
accatcaaagccaccatcctgattgaaaccctgcccgccgtgttccagatggacgaaatt
ctctatcacctgcgtgaccacatcgtcgggctgaactgcggtcgttgggactatatcttc
agctacatcaagacgttgaaaaatcatccggaccgggtattgccggatcgccagtcggtg
accatggacaaaccgtttctgaatgcctattcacgtttgctgatcaaaacctgtcaccgg
cgcggcgcgtttgcgatgggcgggatggccgcgtccattcccagcaaagacgtggagcgc
aacgcctgggtgcaggaaaaagtgcgacaggacaaggaactggaagcccgcaatggtcat
gacggcacctggattgctcaccccggactggccgacacggtgatgccggtgttcgatcgc
ctgctgggcgatcgtcccaatcaactggatatgttgcgcgaagacgatgcgccggtgacc
gccgacgaactgctggcgccttgtccgggagaacgcaccgaagccggtatgcgcgccaat
atccgcgtggcggtgcaatacatcgaagcctggatttccggcaacggctgtgtgccgatt
tacgggctgatggaggatgccgccaccgccgaaatctcccgtacctcgatctggcagtgg
atccaccacggcaaaaccctcagtgacggtcgggtggtgaccaaggcgctatttcgccag
atgctggccgaagagatgcaggttatccgtgttgagctgggcgacgcccgcttcgacggc
ggccgcttcgaggaagccgcccgactgatggaacgcatcaccacgcaggacgcattaatc
gatttcctcaccttacccggttacgacttacttgattaa

DBGET integrated database retrieval system