KEGG   Dickeya dadantii 3937: Dda3937_02128Help
Entry
Dda3937_02128     CDS       T01305                                 

Gene name
aceA
Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00630  Glyoxylate and dicarboxylate metabolism
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01120  Microbial metabolism in diverse environments
ddd01200  Carbon metabolism
Module
ddd_M00012  Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Dda3937_02128 (aceA)
Enzymes [BR:ddd01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Dda3937_02128 (aceA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase ETC_C1_NDUFA4
Motif
Other DBs
NCBI-ProteinID: ADN00255
UniProt: E0SIS7
Position
complement(4357984..4359291)
Genome map
AA seq 435 aa AA seqDB search
MSTSRTQQIEQLEQEWNTPRWKGITRPYRAEDVVNLRGSVNPACTLAQLGAEKLWKLLNG
KSRKGYVNCLGALTGGQALQQAKAGLEAVYLSGWQVAADANLAASMYPDQSLYPSNSVPE
VVQRINNTFRRADQIQWANGIGQDDPRYTDYFLPIVADAEAGFGGVLNAFELMKSMIETG
AAAVHFEDQLASVKKCGHMGGKVLVPTQEAVQKLVAARLAADVLGVPTLLVARTDADAAD
LLTSDCDDYDRDFVTGERTVEGFYRTRAGVEQAISRGLAYAPYADLVWCETSTPDLALAR
RFAEAIHARFPGKLLAYNCSPSFNWKKNLDDRTIARFQDELSEMGYKYQFITLAGIHSMW
FNMFDLAHAYAQGEGMKHYVEKVQQPEFAAIKQGYTFSSHQQEVGTGYFDKVTTLIQGGA
SSVTALTGSTEEQQF
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgagcacctctcgtacccaacaaatcgagcaactggaacaagagtggaacacgccgcgc
tggaaaggcattacccgcccgtatcgcgcggaagacgtggtgaatctgcgcgggtcggtg
aaccctgcctgtacgctggcgcaactgggcgcggaaaagctgtggaagctgttgaacggt
aagtcgcgcaaaggctacgtcaactgccttggcgcgttgaccggcgggcaggcgctgcag
caggcgaaagccgggctggaggcggtgtatctgtccggctggcaggtggcggcggacgcc
aacctggccgccagcatgtacccggatcagtcgctctatccgtccaactcggtgccagag
gtagtgcagcgtatcaacaatactttccggcgggcggatcaaatccagtgggccaacggc
atcgggcaggatgacccacgttacaccgactactttttgccgatcgtggcggatgcggaa
gccggtttcggcggggtgttgaatgcgtttgagctgatgaaatcgatgattgaaacgggc
gccgccgccgtccattttgaagaccaactggcgtcggtgaagaagtgcggccatatgggc
ggcaaggtgctggtgccgacgcaggaagcggtgcagaaactggtagcggcccggctggcg
gcggacgtgctgggcgtaccgaccttgctggtggcgcgtaccgacgccgacgccgccgac
ttgctgacctcggattgtgatgattacgaccgagacttcgttaccggcgaacgcacggtg
gaagggttttaccgtacccgcgccggggtggagcaggcgatcagccgcgggctggcgtac
gcgccttacgccgatctggtgtggtgtgaaacctcaacgcccgacctggcgttggcgcgg
cgtttcgccgaggcgattcacgcccgtttccccggcaagctgctggcctacaactgctcg
ccgtcattcaactggaagaagaatctggacgatcgcaccatcgcccgttttcaggatgaa
ctgtcggagatgggctacaaataccagttcatcacgctggcgggtatccacagcatgtgg
ttcaacatgttcgacctggcgcatgcttatgcgcagggcgaaggcatgaagcactacgtg
gagaaagtacagcagccggaatttgcggccattaaacaagggtataccttctcgtctcac
cagcaggaggtgggcaccggttatttcgacaaggtgaccaccctgattcagggcggcgca
tcgtctgtcaccgcgttgaccggttcgacggaagaacagcagttctga

DBGET integrated database retrieval system