KEGG   Dickeya dadantii 3937: Dda3937_02258Help
Entry
Dda3937_02258     CDS       T01305                                 

Gene name
nagZ
Definition
beta-N-acetylglucosaminidase
Orthology
K01207  
beta-N-acetylhexosaminidase [EC:3.2.1.52]
Organism
ddd  Dickeya dadantii 3937
Pathway
beta-Lactam resistance
Amino sugar and nucleotide sugar metabolism
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Dda3937_02258 (nagZ)
 Human Diseases
  Drug resistance
   00312 beta-Lactam resistance
    Dda3937_02258 (nagZ)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Dda3937_02258 (nagZ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2980658..2981683)
Genome map
AA seq 341 aa AA seqDB search
MGPLMLDVAGYELDAEDREVLAHPLVGGVILFSRNFHDADQLAELVRQMRRASRERLVVS
VDQEGGRVQRFRDGFTALPAAQSFAALNPLPQAQVLAEEAGWVMAAEMIALDIDISFAPV
LDVGHQSTAIGDRSFHDDPDTLLAVAERFIAGMRAAGMKATGKHFPGHGAVTADSHKETP
RDERPLAHIQQRDMRVFRELIARQQLDAVMPAHVIYTDADPRPASGSPYWLKQVLRQELG
FGGIIFSDDLSMEGAAVMGGYAERGQAALDAGCDMILVCNQRQGAISVLDNLSPVKVPGL
ETLYHRGLITRRELLNSSRWKQATSQLTALSERWQAHKAAG
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtggggccgttaatgttagatgtggccggctatgagctggacgcggaagatcgcgaagtg
ctggcgcatccgctggtgggcggcgtgatcctgtttagccgtaactttcatgacgccgac
caactggcggaactggtgcgtcagatgcgtcgcgcttctcgcgagcggctggtggtatcg
gtcgaccaggaaggcggccgcgtgcagcggtttcgcgacggttttaccgcgctgccggcc
gcacagtcgtttgccgcgctgaacccgttgccgcaggcgcaagtgctggcggaggaagcg
ggttgggtgatggcggcggagatgatcgccctggatatcgatatcagcttcgcgccggtg
ctggatgtcgggcaccagagcacggcgattggcgatcgctctttccatgatgacccggac
accttgctggcggtggcggagcgttttattgccggtatgcgtgccgcaggcatgaaggca
acgggcaagcatttccccggacacggtgcggtaacggcggattcccataaagaaacgccg
cgggacgagcggccgctggcacacattcagcagcgggatatgcgggtttttcgggaactg
atcgcccgtcagcagttggatgcggtgatgccggcacacgtgatttataccgatgccgat
cctcgtccggccagcgggtcgccttactggctcaaacaggtgctgcgtcaggagctgggg
ttcggcggcatcatcttctcggatgacctgtcgatggaaggcgcggcggtgatgggcggc
tatgccgagcgcgggcaggcggcgctggatgccggatgcgacatgattctggtctgtaat
cagcggcagggcgcgattagcgtgttggataacctgtctccggtcaaagttccggggctg
gagacgctctatcatcggggattgatcacacgtcgggaactgctgaattcatcgcgctgg
aaacaggcgacgtcgcagttgacggcactgagtgagcgctggcaggcacacaaagccgcc
ggttaa

DBGET integrated database retrieval system