KEGG   Dickeya dadantii 3937: Dda3937_02295Help
Entry
Dda3937_02295     CDS       T01305                                 

Gene name
dsbC
Definition
protein disulfide isomerase II
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
ddd  Dickeya dadantii 3937
Brite
Enzymes [BR:ddd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     Dda3937_02295 (dsbC)
Secretion system [BR:ddd02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   Dda3937_02295 (dsbC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
721572..722288
Genome map
AA seq 238 aa AA seqDB search
MKKRVVLFSLLTLALSGVARADDAAIKQTLNRLGLQSAEVKDSPIGGMKTVLTENGVLYI
TEDGKHLLQGPLYDVSGKTPVNVTNHILNERLDALKDQMIVYKAPQEKHVITVFTDITCG
YCHKLHEQMKDYNALGITVRYLAYPRQGMNSQAAKDMQSIWCVADRNKAFDAAMKGDDVS
PATCKTDIGAHYQLGVLFGVQGTPAIVLDDGTVVPGYQPPKEMMAMLDAHKASLKSGG
NT seq 717 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaacgtgtagtactcttttcattgctgactctggccctgagcggcgtggcgcgc
gccgatgacgccgcaatcaagcagacgctaaaccgtctgggtttgcagagcgcggaagtg
aaggattcccccatcggcgggatgaaaaccgtgctgaccgagaacggcgtgctctatatc
accgaggacggcaaacacctgctgcaagggccgctgtatgacgtcagcggcaagaccccg
gtgaacgttaccaaccatattctgaacgagcgtctggatgcgctgaaagaccagatgatc
gtctataaggcgccgcaggaaaaacatgtcattaccgtgtttaccgacattacctgcggt
tactgccacaagctgcacgagcagatgaaagactacaacgcgctcggcattaccgtgcgt
tatctggcgtatccccgtcagggcatgaattctcaggcggcgaaagacatgcagtcgatc
tggtgcgtggcggatcgcaacaaggcgtttgacgccgctatgaaaggcgatgacgtgtcg
cccgccacctgtaaaaccgatatcggcgcccattatcagctgggcgtgctgttcggcgtg
caggggacgccggcgatcgtgctggacgatggcacggtggtgccgggatatcagccgccc
aaagagatgatggcgatgctggatgcgcacaaagcctcgctgaaatcaggcggttaa

DBGET integrated database retrieval system