KEGG   Dickeya dadantii 3937: Dda3937_02318Help
Entry
Dda3937_02318     CDS       T01305                                 

Gene name
holD
Definition
(GenBank) DNA polymerase III, psi subunit
  KO
K02344  DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00230  Purine metabolism
ddd00240  Pyrimidine metabolism
ddd01100  Metabolic pathways
ddd03030  DNA replication
ddd03430  Mismatch repair
ddd03440  Homologous recombination
Module
ddd_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Dda3937_02318 (holD)
   00240 Pyrimidine metabolism
    Dda3937_02318 (holD)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Dda3937_02318 (holD)
   03430 Mismatch repair
    Dda3937_02318 (holD)
   03440 Homologous recombination
    Dda3937_02318 (holD)
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Dda3937_02318 (holD)
DNA replication proteins [BR:ddd03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Dda3937_02318 (holD)
DNA repair and recombination proteins [BR:ddd03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Dda3937_02318 (holD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_III_psi
Motif
Other DBs
NCBI-ProteinID: ADM96867
UniProt: E0SLN3
Position
complement(699003..699422)
Genome map
AA seq 139 aa AA seqDB search
MTSRRDWLLQQLGITQWTLRRPSVLKGEIAVSLPPDARLLIIADPLPASDDPLLQDVLRS
LNLSPQQIVGLTPRQAQMLPEHTRCHSWWLGQPVADALALDGVQLTSPALAELSHNAGAK
RALWQQICHHEHDFHPDHG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaagacgggactggctgttgcagcaactggggatcacccagtggaccttgcgt
cgtccgtcggtgctgaaaggcgagatcgccgtcagcctgccgcctgacgcccggctgctg
atcatcgccgatccgctgcccgccagcgacgacccgctattgcaggacgtcctgcgcagc
ctgaatctctccccgcagcagatagtcggcctgacgccgcgtcaggcgcagatgctgccg
gaacacacccgctgccacagctggtggctggggcagcccgtcgccgatgcgctggcgttg
gatggcgtacaattgaccagcccggctctggccgagctttctcacaacgccggggcgaaa
cgcgccctgtggcagcagatttgtcaccatgaacatgatttccaccctgaccacggctga

DBGET integrated database retrieval system