KEGG   Dickeya dadantii 3937: Dda3937_02318Help
Entry
Dda3937_02318     CDS       T01305                                 

Gene name
holD
Definition
DNA polymerase III subunit psi
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
ddd  Dickeya dadantii 3937
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ddd00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ddd00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:ddd03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:ddd03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ddd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(699003..699422)
Genome map
AA seq 139 aa AA seqDB search
MTSRRDWLLQQLGITQWTLRRPSVLKGEIAVSLPPDARLLIIADPLPASDDPLLQDVLRS
LNLSPQQIVGLTPRQAQMLPEHTRCHSWWLGQPVADALALDGVQLTSPALAELSHNAGAK
RALWQQICHHEHDFHPDHG
NT seq 420 nt NT seq  +upstreamnt  +downstreamnt
atgacatcaagacgggactggctgttgcagcaactggggatcacccagtggaccttgcgt
cgtccgtcggtgctgaaaggcgagatcgccgtcagcctgccgcctgacgcccggctgctg
atcatcgccgatccgctgcccgccagcgacgacccgctattgcaggacgtcctgcgcagc
ctgaatctctccccgcagcagatagtcggcctgacgccgcgtcaggcgcagatgctgccg
gaacacacccgctgccacagctggtggctggggcagcccgtcgccgatgcgctggcgttg
gatggcgtacaattgaccagcccggctctggccgagctttctcacaacgccggggcgaaa
cgcgccctgtggcagcagatttgtcaccatgaacatgatttccaccctgaccacggctga

DBGET integrated database retrieval system