KEGG   Dickeya dadantii 3937: Dda3937_02327Help
Entry
Dda3937_02327     CDS       T01305                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
ddd  Dickeya dadantii 3937
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Dda3937_02327 (deoA)
Enzymes [BR:ddd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Dda3937_02327 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
691770..693101
Genome map
AA seq 443 aa AA seqDB search
MFLIQEIIRKKRDGHPLSAEEIRFFINGVRDNTVSEGQIAALAMTVFFHDMNMDERVALT
LAMRDSGTVLDWSGLNLNGPLVDKHSTGGVGDVTSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKLESIPGLDIFPEDDAFRQIIRQVGVAIIGQTNSLAPADKRFYATRDITATVDSI
PLITASILAKKLAEGLDALVMDVKVGSGAFMPTYEQSEQLAQAIVGVANNAGCRTSALLT
DMSQVLASSAGNALEVREAVRFLTGEQRNPRLFEVTMALCESMLLAGHLARDAAEARAKL
QAVLDNGRAAEVFGRMVAAQHGPMDFVEQYDRYLSPATLSKPVFAERDGFVGAMDARALG
MVVVALGGGRRQASDIIDHSVGLSDMVSLGDRVDAQRPLAVIHARTESDWQQAAQALREA
IRLDDQPPAPCPLIYRRLDAADI
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
ttgtttctgattcaggaaattatccgcaaaaaacgggacggtcatccgctcagtgcggaa
gaaattcgctttttcattaacggtgtgcgcgataacaccgtgtcggaagggcagatcgcc
gcgctggcgatgaccgtgttctttcacgatatgaacatggatgagcgggtggcgctgacg
ctggcgatgcgcgattccggcaccgtgctggactggtccgggctgaatctcaacggcccg
ctggtggataagcactcgaccggtggcgtcggcgatgtcacgtcgctgatgctggggccg
atggtggcggcctgcggcgggtatgtgccgatgatttccggtcgcggtctgggtcacacc
ggcggtacgctggacaagctggaatcgataccggggctggatatcttcccggaggatgac
gctttccggcagatcatccgtcaggttggcgtggcgattatcgggcaaaccaactcgctg
gcgccggcggacaagcgtttctacgccacccgcgatatcaccgccaccgtcgactccatt
ccgctgatcaccgcctcgattctggcgaaaaagctggcggaagggttagacgcgctggtg
atggacgtcaaagtcggctccggcgcgtttatgccgacctacgaacagtcggagcaactg
gcgcaggcgattgtcggcgtagctaataatgccggctgccgcaccagcgcgctgttgacc
gacatgagtcaggtgctggcttccagcgccggcaatgcgctggaagtacgtgaagcggtg
cgctttctgaccggcgagcaacgcaatccgcggctgttcgaggtgacgatggcgttgtgc
gaatccatgctgctggcggggcacctggcgcgcgatgccgccgaggcgcgagcaaaattg
caggcggtgctggataacggccgggcggcggaggtctttggccgcatggtggcggcccag
catggcccgatggattttgtcgaacagtacgatcgctatctgtcgcccgcgacgctcagt
aaaccggtgttcgccgagcgcgacggctttgtcggcgcgatggatgcgcgcgcgttgggc
atggtagtggtggcgttgggtggtggtcgacgtcaggccagtgatatcattgatcacagt
gtcgggctgagcgacatggtcagtctgggcgatcgggtggatgcgcagcgtccgctggcg
gtaatccacgccagaaccgagtccgactggcaacaggccgcgcaggcgctgcgtgaggcg
attcgccttgatgatcaaccgcctgcgccttgtccgctgatttatcgtcgactggacgcc
gcggacatctaa

DBGET integrated database retrieval system