KEGG   Dickeya dadantii 3937: Dda3937_02346Help
Entry
Dda3937_02346     CDS       T01305                                 

Gene name
folP
Definition
(GenBank) 7,8-dihydropteroate synthase
  KO
K00796  dihydropteroate synthase [EC:2.5.1.15]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00790  Folate biosynthesis
ddd01100  Metabolic pathways
Module
ddd_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Dda3937_02346 (folP)
Enzymes [BR:ddd01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Dda3937_02346 (folP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pterin_bind
Motif
Other DBs
NCBI-ProteinID: ADM96838
UniProt: E0SKX5
Position
670316..671251
Genome map
AA seq 311 aa AA seqDB search
MTAPGGPLLTPNPGLPGFFTPGRHAGWTNFEKQNMKLNARGLTLDLSCPQIMGILNVTPD
SFSDGGKHNTLNSALVHAEQMISAGATFIDVGGESTRPGADEVSTEEELERVVPVVEALA
QRFETWISVDTSKPEVITACAQAGAHLINDIRALREPGALEAAAATGLPVCLMHMQGLPR
TMQHTPHYDDVVGEVSAFFEHHIARCVTTGISRDQLLLDPGFGFGKNLQHNYRLLGHLEE
LHRFGLPLLVGMSRKTMIGQLLGVPPLERVHGSVACAVIAAMKGAHIIRVHDVKATVDAI
RVVEATLSAKE
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
atgacggcccctggcgggccgctgctcactccaaaccccggcttgccggggttttttact
ccgggaaggcatgctggctggacgaattttgagaagcaaaacatgaaactgaatgcgcgt
ggattgacgctggatctctcctgcccccagattatggggattttgaatgtaaccccggat
tccttctctgacggcggtaaacacaatactctgaattctgccttggtccatgccgagcag
atgatttctgccggcgccactttcattgatgtgggaggcgaatctacccgaccgggcgca
gatgaagtcagtaccgaggaagaactggagcgggttgtgccggtggtggaagcgttggcg
caacgctttgaaacctggatttcggtggatacgtccaagccggaggtgattaccgcctgc
gcgcaggccggtgcacacctgatcaacgatattcgtgcgcttagagagccgggggcgctg
gaagcggcggcggcaacaggccttcctgtgtgcttgatgcacatgcagggattgccaaga
accatgcaacatacgccgcattatgacgacgtggtaggtgaggtttcggcgttttttgag
catcatattgcccgttgtgtcacaaccggtatttcgcgcgaccagttattgctggatcca
ggattcggcttcggcaagaatctgcagcataattatcggttgctgggtcatctggaagaa
ttacatcgcttcggtttgccgttgctggttggtatgtccagaaaaaccatgattgggcaa
ttactgggtgttccgccgcttgaacgggttcatggcagtgtcgcatgcgcggttattgcc
gcgatgaagggcgctcatattatccgtgtccatgatgtgaaagcgacggtggatgcaata
cgtgtagtcgaagcaactctatcagcgaaggaataa

DBGET integrated database retrieval system