KEGG   Dickeya dadantii 3937: Dda3937_02393Help
Entry
Dda3937_02393     CDS       T01305                                 

Gene name
ganB
Definition
1,4-beta-exogalactanase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ddd  Dickeya dadantii 3937
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ddd00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3419825..3421882)
Genome map
AA seq 685 aa AA seqDB search
MKRFTPLNPKVEGLLHGADYNPEQWENYPGIIDDDIAMMKQVKCNVMSVGIFSWAKLEPQ
EGVYRFDWLDEVIDKLYRQGIAVFLATPSGARPAWMSQRYPEVLRVGRDRVPALHGGRHN
HCLSSPVYRDKVAKINTLLAERYGHHPAVIGWHISNEYSGECHCDRCQQAFRNWLQARYQ
TLDNLNHAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQATDFCAQEIVP
LKRVNPAIPVTTNFMEYFYDYDYWQLSRVLDFISWDSYPMWHRDKDDATLACYIAMFHDL
MRSLKQGKPFVLMESTPSVTNWQPLSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVAQLGQILSQLDAVAGSRVEAQVAILFDWESRWAMDDA
QGPRNAGLEYETTVAEHYRPFWEQGIAADIINADCDFSGYRLLIAPMLYMVRPGFAERVE
QFVRQGGQVVVTYWSGIVNESDLCYQGGFPGPLRAVLGIWSEEIDCLADGEYNRVQGLAD
NDIGLKGPYQARHLCELIHLEGATALASYCDDFYAGRPAVTVNRVGAGKAWYVTSRNDLA
FQRDFFGAIIRELALPRALDIPLPPAVTAHRRTNGDDEFIFIENYSAQPQPIQLPAGYSD
MLTGLPLVDVVLSAWDCRVIRRRLI
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatttacgcctttgaatccgaaggtggaagggttattgcatggcgctgattat
aatccggagcaatgggagaattaccccggcattattgatgacgatatcgccatgatgaaa
caggtgaaatgtaatgtcatgtcggtcggtattttcagctgggccaaactggagccgcag
gaaggcgtgtatcggttcgactggctggatgaggttatcgataaattatatcgacagggc
attgcggtgtttctggctacgcccagcggcgcccgcccggcatggatgtcgcaacgttat
ccggaagtgctgcgcgtcgggcgcgaccgggtgccggcgctgcacggcggtcgccataac
cactgtctgtcgtcgccggtgtaccgcgataaagtagcgaaaatcaatacgctgctggca
gaacgctacgggcatcacccggcggtgatcggctggcacatctctaatgaatacagcggc
gaatgccattgcgatcgctgtcagcaggcgtttcgcaactggttgcaggcgcgttatcag
acgctggacaacctcaatcacgcctggtggagcgatttctggagccatacctacagcgac
tggtcgcagattgaatcgccggcgccgcagggtgaagtgtccattcacggcttgaacctc
gactggcgacgctttaataccgcgcaggcgaccgatttctgcgcgcaggaaatcgttccg
ttgaagcgggtgaacccggctatcccggtcaccaccaatttcatggagtatttctacgat
tacgattactggcaactgtcgcgcgtgctggatttcatctcctgggacagctacccgatg
tggcaccgcgacaaggacgacgccacgctggcctgttatatcgcgatgttccatgacctg
atgcgctcgctcaagcagggcaagccgtttgtgttgatggagtcgacccccagcgtcacc
aactggcaaccgctcagcaagctcaagaagccgggcatgcatattctctcctcgctacag
gcggtggcccacggcgcggacgcggtgcagtatttccagtggcgcaagagccgtggttcg
gtggagaaattccacggcgcggtggtggatcacgtcggtcatatcgatacccgcgtcggc
cgcgaagtggcgcaactcggccagatattgtctcagctggatgcggtggcgggcagccgg
gtagaggcgcaggtggcgatcctgtttgactgggaaagccgctgggcgatggatgacgcg
caggggccgcgcaatgccgggctggagtacgaaacaaccgtggcggaacattaccgcccg
ttctgggagcaggggatcgcggcggacatcatcaacgccgactgcgatttcagcggctat
cggctgttgattgcgccgatgttgtacatggtgcgcccaggctttgccgagcgtgtcgag
cagtttgtgcggcagggcgggcaggtggtggtgacctactggagcggcatcgttaacgaa
agcgacctgtgttatcagggcggattccccggtccgctgcgcgcggtgctggggatctgg
tcagaagagatcgactgtctggccgacggcgaatacaaccgggtacaggggctggcggac
aatgatatcgggctgaaagggccgtatcaggcgcgccacctgtgcgagttgatccacctt
gaaggcgcgacggcgctcgccagttactgtgacgatttctacgccggccggccggcggtg
acggtaaaccgcgtcggcgcagggaaggcctggtacgtgacttcgcgtaatgatctggcg
ttccaacgcgatttctttggcgccatcatccgtgagctggctctgccgcgggcgttggat
atcccgctgccgccggcggtaacggcccatcgtcgtaccaacggcgacgacgagtttatc
ttcatcgaaaactacagtgcgcagccgcagccaattcaactgcccgccgggtatagcgat
atgctgaccgggttgcctctggtagacgttgtcctttccgcctgggattgccgggtgatt
cgccgccgtctgatctga

DBGET integrated database retrieval system