KEGG   Dickeya dadantii 3937: Dda3937_02393Help
Entry
Dda3937_02393     CDS       T01305                                 

Gene name
ganB
Definition
1,4-beta-exogalactanase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ddd  Dickeya dadantii 3937
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dda3937_02393 (ganB)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Dda3937_02393 (ganB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
Position
complement(3419825..3421882)
Genome map
AA seq 685 aa AA seqDB search
MKRFTPLNPKVEGLLHGADYNPEQWENYPGIIDDDIAMMKQVKCNVMSVGIFSWAKLEPQ
EGVYRFDWLDEVIDKLYRQGIAVFLATPSGARPAWMSQRYPEVLRVGRDRVPALHGGRHN
HCLSSPVYRDKVAKINTLLAERYGHHPAVIGWHISNEYSGECHCDRCQQAFRNWLQARYQ
TLDNLNHAWWSDFWSHTYSDWSQIESPAPQGEVSIHGLNLDWRRFNTAQATDFCAQEIVP
LKRVNPAIPVTTNFMEYFYDYDYWQLSRVLDFISWDSYPMWHRDKDDATLACYIAMFHDL
MRSLKQGKPFVLMESTPSVTNWQPLSKLKKPGMHILSSLQAVAHGADAVQYFQWRKSRGS
VEKFHGAVVDHVGHIDTRVGREVAQLGQILSQLDAVAGSRVEAQVAILFDWESRWAMDDA
QGPRNAGLEYETTVAEHYRPFWEQGIAADIINADCDFSGYRLLIAPMLYMVRPGFAERVE
QFVRQGGQVVVTYWSGIVNESDLCYQGGFPGPLRAVLGIWSEEIDCLADGEYNRVQGLAD
NDIGLKGPYQARHLCELIHLEGATALASYCDDFYAGRPAVTVNRVGAGKAWYVTSRNDLA
FQRDFFGAIIRELALPRALDIPLPPAVTAHRRTNGDDEFIFIENYSAQPQPIQLPAGYSD
MLTGLPLVDVVLSAWDCRVIRRRLI
NT seq 2058 nt NT seq  +upstreamnt  +downstreamnt
atgaaacgatttacgcctttgaatccgaaggtggaagggttattgcatggcgctgattat
aatccggagcaatgggagaattaccccggcattattgatgacgatatcgccatgatgaaa
caggtgaaatgtaatgtcatgtcggtcggtattttcagctgggccaaactggagccgcag
gaaggcgtgtatcggttcgactggctggatgaggttatcgataaattatatcgacagggc
attgcggtgtttctggctacgcccagcggcgcccgcccggcatggatgtcgcaacgttat
ccggaagtgctgcgcgtcgggcgcgaccgggtgccggcgctgcacggcggtcgccataac
cactgtctgtcgtcgccggtgtaccgcgataaagtagcgaaaatcaatacgctgctggca
gaacgctacgggcatcacccggcggtgatcggctggcacatctctaatgaatacagcggc
gaatgccattgcgatcgctgtcagcaggcgtttcgcaactggttgcaggcgcgttatcag
acgctggacaacctcaatcacgcctggtggagcgatttctggagccatacctacagcgac
tggtcgcagattgaatcgccggcgccgcagggtgaagtgtccattcacggcttgaacctc
gactggcgacgctttaataccgcgcaggcgaccgatttctgcgcgcaggaaatcgttccg
ttgaagcgggtgaacccggctatcccggtcaccaccaatttcatggagtatttctacgat
tacgattactggcaactgtcgcgcgtgctggatttcatctcctgggacagctacccgatg
tggcaccgcgacaaggacgacgccacgctggcctgttatatcgcgatgttccatgacctg
atgcgctcgctcaagcagggcaagccgtttgtgttgatggagtcgacccccagcgtcacc
aactggcaaccgctcagcaagctcaagaagccgggcatgcatattctctcctcgctacag
gcggtggcccacggcgcggacgcggtgcagtatttccagtggcgcaagagccgtggttcg
gtggagaaattccacggcgcggtggtggatcacgtcggtcatatcgatacccgcgtcggc
cgcgaagtggcgcaactcggccagatattgtctcagctggatgcggtggcgggcagccgg
gtagaggcgcaggtggcgatcctgtttgactgggaaagccgctgggcgatggatgacgcg
caggggccgcgcaatgccgggctggagtacgaaacaaccgtggcggaacattaccgcccg
ttctgggagcaggggatcgcggcggacatcatcaacgccgactgcgatttcagcggctat
cggctgttgattgcgccgatgttgtacatggtgcgcccaggctttgccgagcgtgtcgag
cagtttgtgcggcagggcgggcaggtggtggtgacctactggagcggcatcgttaacgaa
agcgacctgtgttatcagggcggattccccggtccgctgcgcgcggtgctggggatctgg
tcagaagagatcgactgtctggccgacggcgaatacaaccgggtacaggggctggcggac
aatgatatcgggctgaaagggccgtatcaggcgcgccacctgtgcgagttgatccacctt
gaaggcgcgacggcgctcgccagttactgtgacgatttctacgccggccggccggcggtg
acggtaaaccgcgtcggcgcagggaaggcctggtacgtgacttcgcgtaatgatctggcg
ttccaacgcgatttctttggcgccatcatccgtgagctggctctgccgcgggcgttggat
atcccgctgccgccggcggtaacggcccatcgtcgtaccaacggcgacgacgagtttatc
ttcatcgaaaactacagtgcgcagccgcagccaattcaactgcccgccgggtatagcgat
atgctgaccgggttgcctctggtagacgttgtcctttccgcctgggattgccgggtgatt
cgccgccgtctgatctga

DBGET integrated database retrieval system