KEGG   Dickeya dadantii 3937: Dda3937_02455Help
Entry
Dda3937_02455     CDS       T01305                                 

Gene name
acs
Definition
(GenBank) Acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00010  Glycolysis / Gluconeogenesis
ddd00620  Pyruvate metabolism
ddd00640  Propanoate metabolism
ddd00680  Methane metabolism
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01120  Microbial metabolism in diverse environments
ddd01130  Biosynthesis of antibiotics
ddd01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_02455 (acs)
   00620 Pyruvate metabolism
    Dda3937_02455 (acs)
   00640 Propanoate metabolism
    Dda3937_02455 (acs)
  Energy metabolism
   00680 Methane metabolism
    Dda3937_02455 (acs)
Enzymes [BR:ddd01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Dda3937_02455 (acs)
Lipid biosynthesis proteins [BR:ddd01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Dda3937_02455 (acs)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ADM96927
UniProt: E0SLU3
Position
complement(761628..763589)
Genome map
AA seq 653 aa AA seqDB search
MSQYNKHPIPATIAENALITAEQYKKMYQESVQDPDAFWREQGKIVDWIKPYHQVKNTSF
DPGHVRIRWFEDGTLNVAANCLDRHLDTMGDQTAIIWEGDDAGESKKVTYRELHQAVCRF
ANVLKSKGIRKGDVVAIYMPMVPEAAVAMLACARVGAVHSVIFGGFSPESIAGRIVDSSA
KLVVTADEGIRAGRAIPLKKNIDEALRNPAVTSVNHVIVFQRTGKPGNWQDGRDLWWHEL
IAQVDDHCPPEEMNAEDPLFILYTSGSTGKPKGVLHTTGGYLVYAAATFKYVFDYHPGDV
YWCTADVGWVTGHSYLLYGPLACGAITLMFEGVPNWPTASRMGQVVDKHQVNILYTAPTA
IRALMADGDKAIEGTSRQSLKIMGSVGEPINPEAWEWYFKKIGNSRCPIVDTWWQTETGG
FMITPLPGAIEAKPGSATLPFFGVQPALVDNLGNPQDGACEGNLVITDSWPGQARTLFGD
HERFEQTYFSTFKGMYFSGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVSHP
KIAEAAVVGIPHSLKGQAIYAYITLNHGEEPTSELYTEVRNWVRKEIGPIATPDILHWTD
ALPKTRSGKIMRRILRKIAAGDTSNLGDISTLADPGVVEKLLEEKQAMSHTSS
NT seq 1962 nt NT seq  +upstreamnt  +downstreamnt
atgagccaatataataaacaccctatacccgccaccattgcggaaaacgccttaatcacc
gccgaacaatataaaaagatgtatcaggaatctgtgcaggatcctgatgccttctggcgg
gaacaaggcaagatcgttgattggatcaaaccctatcaccaggtcaaaaacacctctttt
gacccgggccatgtccgtatccgctggttcgaggacggtacattaaatgtagcggccaac
tgcctcgatcgtcatctcgacacgatgggcgatcaaaccgcgatcatctgggaaggcgac
gacgccggggaaagcaaaaaagtcacctaccgcgagctgcatcaggcggtttgccgtttc
gccaacgtgctgaaatctaaaggcatccgtaaaggcgatgtggtcgctatttatatgccg
atggtgccggaagccgccgtggcgatgctggcctgcgcccgcgtcggcgccgtgcattcg
gtgatcttcggcggattctccccggaatccatcgccgggcgcatcgtcgactccagcgcc
aaactggtggtcaccgccgatgaaggcattcgcgccggacgagccattccgctgaaaaag
aacattgacgaagccctgcgcaacccggcggtcaccagcgtcaaccatgtgatcgttttc
cagcgtaccggcaagcccggcaactggcaggacggccgggatctgtggtggcacgagttg
atcgcccaggtggacgatcattgcccgccggaagaaatgaacgctgaagatccgctgttt
attctgtatacctccggctctaccggtaaaccgaaaggggtgctgcacaccaccggcggt
tatctggtttacgccgccgccacctttaaatacgtgttcgactaccaccccggcgacgtt
tactggtgtaccgccgacgtcggctgggtaaccggtcatagttacctgttgtacggcccg
ctggcctgcggcgccatcacgctgatgtttgaaggcgtacccaactggcctaccgccagc
cgtatggggcaagtggtggacaagcatcaggtcaatatcttgtataccgcgcccaccgcc
attcgcgcgctgatggcggacggcgacaaggcgattgaaggcacctcgcgccagtcgctc
aaaatcatgggctcggtaggggaacccatcaacccggaagcctgggaatggtacttcaaa
aaaatcggcaatagccgctgcccgatcgtcgacacctggtggcagacggaaaccggggga
ttcatgatcacgccgttgcccggcgccatcgaagccaaaccgggttcggcgacgctgccg
tttttcggggtgcaaccggcactggtggacaacctcggcaacccgcaggacggcgcctgc
gaaggcaacctggtgattaccgactcctggcccggtcaggcgcgtacgctgtttggcgac
catgagcgctttgagcagacctatttctccaccttcaaaggcatgtatttcagcggcgac
ggcgcacgccgcgacgaagacggctattactggatcaccggccgcgtggacgatgtgctg
aacgtctccggccaccgtctcggcaccgcggaaatcgaatccgcgctggtttcacacccg
aaaatcgccgaagcggcggtggtcggcattccgcacagcctcaaggggcaggcgatctat
gcctacatcaccttgaatcacggcgaagagcctaccagcgagctgtataccgaggtgcgc
aactgggtgcgcaaagagatcggccccatcgccaccccggatatcctgcactggaccgat
gcgctaccgaaaacccgatccggcaaaatcatgcggcgtattctgcgcaagattgcagcc
ggggataccagcaatcttggggatatctccaccctcgccgatcctggcgtggtagagaaa
ctgctggaagaaaaacaagccatgagccacacatcgtcttaa

DBGET integrated database retrieval system