KEGG   Dickeya dadantii 3937: Dda3937_02475Help
Entry
Dda3937_02475     CDS       T01305                                 

Gene name
gltL
Definition
glutamate/aspartate ABC transporter ATP-binding protein
Orthology
K10004  
glutamate/aspartate transport system ATP-binding protein [EC:3.6.3.-]
Organism
ddd  Dickeya dadantii 3937
Pathway
ABC transporters
Two-component system
Module
Glutamate/aspartate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ddd02010]
Environmental Information Processing; Signal transduction; Two-component system [PATH:ddd02020]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1392583..1393308)
Genome map
AA seq 241 aa AA seqDB search
MIFLKNVSKWYGQFQVLTDCSTEVKKGEVVVVCGPSGSGKSTLIKTVNGLEPIQQGQIDV
NGITVSDKRTNLAQLRAKVGMVFQHFELFPHLSIVDNLTLAQVKVLKRDKETAREKGLKL
LARVGLSAHANKFPGQLSGGQQQRVAIARALCMDPVAMLFDEPTSALDPEMINEVLDVMV
ELAQEGMTMMVVTHEMGFARKVAHRVIFMDEGKIIEDTRKEDFFSNPQSDRAKDFLAKIL
H
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgattttcctgaaaaatgtttctaaatggtatggtcaatttcaggtgctgaccgactgc
tccaccgaagtgaaaaaaggtgaagtggtggtggtttgcggaccttccggctccgggaaa
tcgaccctaatcaaaaccgttaacggcctggagccgatacagcaaggacagatcgatgtt
aacggcatcactgtcagtgacaaacgcaccaatctggcgcaattacgcgccaaagtcggg
atggtgttccagcactttgagctgtttcctcacttgtccatcgttgacaacctgacgctg
gcgcaggtcaaagtactcaaacgcgataaagaaaccgcccgcgaaaaagggctgaagctg
ctggcgcgcgtcggtctgtcggcccatgccaacaagttccccggccagctgtccggcggc
cagcagcagcgtgtggccatcgcccgcgccctgtgtatggatccggtggcgatgctgttt
gacgaaccgacctcggcgctcgacccggaaatgatcaatgaagtgctggacgtgatggtg
gagctggcgcaagaaggcatgaccatgatggtggtaacccacgagatgggattcgcccgc
aaggtggcgcaccgcgttatcttcatggatgaaggcaagatcattgaagacactcgcaaa
gaggacttcttcagcaatccgcaatccgaccgcgctaaagactttctggcgaaaatcctg
cattaa

DBGET integrated database retrieval system