KEGG   Dickeya dadantii 3937: Dda3937_02591Help
Entry
Dda3937_02591     CDS       T01305                                 

Definition
beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycolysis / Gluconeogenesis
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_02591
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Dda3937_02591
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3947326..3948729)
Genome map
AA seq 467 aa AA seqDB search
MIMARFPQGFLWGGAIAANQAEGAWNEDGKGPSIADVVRGGIVAGKPDAAIDPASYYPSH
EAIDFYHRYRDDIALFAEMGFKCFRTSIAWSRIFPQGDEAQPNEAGLRFYDNLFDELLKY
GIQPVITLSHYETPLALYQRYGGWHNRKLVEYFVRYCDTVFRRYRHKVKYWMTFNELNNM
NRIPFATGAIQPEPEARLQAIYQAGHHMFVANALANQLCHQIIPDARIGCMLSLSTVYPH
SCHPDDVFETMQMRRRSLFYADVMMRGHYPAYSQRMWRDHGIELAMEEGDLALLAAHPSD
YLSFSYYRSATYQAGMPVLADTGGVIGKENPYLQSTDWGWPIDAKGLRLVCNELADRYEK
PLFIVENGFGGVDVPDADGLINDDDRIRYGQQHLREVAEALADGCDIMGYTWWGPIDIVS
AGTGEMKKRYGFIYVDKDNDGHGTLARRRKKSFDWYRQVIASNGEQL
NT seq 1404 nt NT seq  +upstreamnt  +downstreamnt
gtgatcatggctcgtttcccgcaagggtttttatggggcggcgcgattgccgccaatcag
gcggaaggcgcctggaatgaggacggcaaagggccgtcgattgccgatgtggtgcgcggc
ggcatcgtggcgggcaagccggatgcggcgattgacccggcgagttactaccctagccac
gaggcgatcgatttttatcaccgctatcgggacgacatcgccctgttcgccgaaatgggg
ttcaaatgctttcgcacctcgatcgcctggtcgcgcattttcccgcagggggatgaggcg
cagcccaacgaggcggggctgcgtttttacgacaacctgtttgacgaactgctgaaatac
ggcatccagccggtgattaccctgtcgcactatgaaacgccgctggcgctgtaccagcgc
tacggcggctggcacaaccgtaaactggtggagtatttcgtccgctattgcgacacggtg
tttcgccgttaccggcacaaggtgaaatactggatgacgttcaacgaactgaacaacatg
aaccgcatcccgtttgctaccggcgccattcagccagagccggaagcgcggctacaggca
atttatcaggccggccatcacatgttcgtcgccaacgcgctggctaaccagttgtgccac
cagatcatcccggacgcccgcatcggctgcatgttgtcgctgagcaccgtctatccgcac
agttgccatccggatgacgtgttcgaaaccatgcagatgcggcgtcgctcgctgttttac
gccgatgtgatgatgcgtggtcactatccggcttacagtcagcgcatgtggcgcgatcac
ggcattgaactggcgatggaggagggcgatctggcgttgctggcggcacacccgtccgac
tacctcagtttcagctattaccgcagcgccacttatcaggccggtatgccggtgctggcg
gataccggcggggtgatcggcaaggaaaatccgtatctgcaaagcaccgactggggttgg
ccgattgacgccaaagggttgcggctggtgtgtaacgaactggcggatcgctatgaaaag
ccgctgtttattgtcgaaaatggctttggcggcgtggacgtaccggacgcggacggcctc
atcaacgatgacgaccgtatccgctatgggcaacagcatctgcgcgaggtggcggaagcc
ctggccgacggctgcgacatcatggggtacacctggtgggggccgattgatatcgtcagc
gccggcaccggcgagatgaaaaagcgctacggttttatctacgtggataaagacaatgac
ggccacggcacgctggcgcgtcgcaggaaaaagagctttgactggtatcggcaggtgatc
gccagtaacggcgaacagctgtaa

DBGET integrated database retrieval system