KEGG   Dickeya dadantii 3937: Dda3937_02691Help
Entry
Dda3937_02691     CDS       T01305                                 

Gene name
dcyD
Definition
D-cysteine desulfhydrase
Orthology
K17950  
L-cysteate sulfo-lyase [EC:4.4.1.25]
Organism
ddd  Dickeya dadantii 3937
Pathway
Cysteine and methionine metabolism
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dda3937_02691 (dcyD)
Enzymes [BR:ddd01000]
 4. Lyases
  4.4  Carbon-sulfur lyases
   4.4.1  Carbon-sulfur lyases (only sub-subclass identified to date)
    4.4.1.25  L-cysteate sulfo-lyase
     Dda3937_02691 (dcyD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1701051..1702064
Genome map
AA seq 337 aa AA seqDB search
MHLARFPRLSLGHFPTPLEPLPRLSAYLGGPTIYIKRDDATGLATGGNKTRKLEFLLAEA
LQQDADVIITQGATQSNHVRQTIAAAAKLGLKTQVLLEKRVEDYGVDYQRSGNVLLDKLL
GGDIVDHLPAGTDMQQAMEVLAATLREQGHRPYVIPGGGSSPTGALGYVACAEELLYQSS
QQRLRIDHIVHATGSTGTQAGLVAGLTASNSGIPVLGISVRAPKAKQEENVWQLAQRTWQ
KLGLAGEVPREAIQVNSDYVGQGYGIPTAGTLEALTLAAQLEGILLDPVYSGKALAGLID
LARQGRFGKDENVLFIHTGGSAGLFGYRQLFEQQEGW
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
atgcatctcgcccgttttccccgcttatcgctgggccatttccctacgccgctggaaccg
ctgccgcgtttatccgcttatctcggcggcccgacgatttatatcaaacgtgacgacgct
accgggctggcgaccggtggaaataaaacccgcaagctcgaatttctgctggcggaagcc
ttgcagcaggacgccgatgtcatcatcacccagggcgctacccagtccaaccatgtacgg
cagaccattgccgccgcggcgaaactggggctgaaaacccaggtactgctggaaaaacgg
gttgaggattacggcgtggattatcagcgttccggcaacgtgctgctggataagctgctg
ggcggcgacattgttgaccacctgccggccggcaccgatatgcagcaggcgatggaggtg
ttggccgccacgttgcgcgagcagggacaccgcccctatgtgatccccggcggcggctcc
agcccgaccggcgcgctggggtacgtcgcctgtgctgaagagctgttgtatcagtccagc
cagcagcggttgcgcatcgaccatatcgtacacgccaccggcagcaccggcactcaggcc
gggctggttgccgggttgaccgccagcaacagcggcattccggtgctgggcatcagcgtg
cgtgcgccgaaggcgaagcaggaagaaaacgtctggcaactggcgcagcgcacctggcag
aagctggggctggcgggcgaggtgccgcgcgaggctatccaggttaacagcgactacgtc
gggcaaggatacggcattcccaccgccggaacgctggaggctctgacgctggcggcgcaa
ctggaaggcattttgctggacccggtctattccggcaaggcactggccgggttgatcgat
ctggcgcgccaggggcggttcggcaaggatgaaaacgtgttgtttattcataccggcggg
tcggccgggctgtttggttaccgccaactgttcgaacagcaggaaggctggtga

DBGET integrated database retrieval system