KEGG   Dickeya dadantii 3937: Dda3937_02739Help
Entry
Dda3937_02739     CDS       T01305                                 

Gene name
uxaC
Definition
uronate isomerase
Orthology
K01812  
glucuronate isomerase [EC:5.3.1.12]
Organism
ddd  Dickeya dadantii 3937
Pathway
Pentose and glucuronate interconversions
Metabolic pathways
Module
D-Glucuronate degradation, D-glucuronate => pyruvate + D-glyceraldehyde 3P
D-Galacturonate degradation (bacteria), D-galacturonate => pyruvate + D-glyceraldehyde 3P
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dda3937_02739 (uxaC)
Enzymes [BR:ddd01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.12  glucuronate isomerase
     Dda3937_02739 (uxaC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
621865..623283
Genome map
AA seq 472 aa AA seqDB search
MPQFLSEDFLLDTEFARRLYHEFAADQPIFDYHCHLPPAQIAENYRFKNLYDIWLKGDHY
KWRAMRTNGVPERLCTGDASDWEKFEAWAATVPHTIGNPLYHWTHLELRRPFGVTGTLLS
PSTAKDIWNRTNALLERDEFTARGIMQQMNVKMVGTTDDPIDDLLHHKAVAQDKTFSIKV
LPSWRPDKAFNIELATFNDYMAKLGEVSDTDIRRFSDLQAALTKRLDHFAAHGCKVSDHA
LDVVLYADADEATLDGILARRLSGATLSEHEVAQFKTAVLVWLGAEYARRGWVQQYHIGA
LRNNNLRQFNLLGPDVGFDSINDRPMAQELSRLLSKQNEENLLPKTILYCLNPRDNEVLG
TMIGNFQGEGMPGKMQFGSGWWFNDQKDGMQRQMTQLAQLGLLSRFVGMLTDSRSFLSYT
RHEYFRRILCQMIGRWVEDGEAPGDLPLLGEMVKNICFDNAKNYFGIELYQK
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgccccagtttttaagtgaagattttttgttggataccgagtttgcccgtcggctgtac
catgaatttgcagcggatcagccaatttttgattaccactgccatttaccgcctgcgcag
attgccgaaaattaccgctttaaaaacctgtatgacatctggctgaaaggcgaccattac
aaatggcgtgccatgcgcaccaacggcgtaccggagcgtttgtgtaccggcgacgccagc
gactgggagaaattcgaagcctgggccgccaccgtaccgcataccatcggcaacccgctg
tatcactggacgcatctggaactgcgccgtccgttcggcgtcaccggcaccctgctgtcg
ccgtctaccgctaaagacatctggaaccgcaccaacgccctgctggagcgtgacgaattc
acggcgcgcggcatcatgcagcagatgaacgtgaaaatggtcggcaccaccgacgatccg
atcgacgacctgctgcatcacaaagcggttgcccaggataaaaccttctctatcaaggtg
ctgccgagctggcgtcctgacaaggcattcaatatcgaactggcgacctttaacgactac
atggcgaagctcggcgaagtgtccgataccgacatccgtcgtttcagcgacctgcaggcg
gcgctgaccaagcgtctggaccacttcgccgcgcacggttgtaaagtgtccgaccacgcg
ctggacgtcgtgttgtacgccgatgcggatgaagccacgctggatggcattctggcccgc
cgcctgtccggcgccaccctgagcgaacacgaagtggcgcagttcaaaaccgcggtgctg
gtatggctgggcgccgaatacgcgcgtcgcggctgggtgcagcagtaccacatcggcgcg
ctgcgcaacaataacctgcgtcagttcaatctgctggggccggacgtgggcttcgattcc
atcaacgaccgcccgatggcgcaggaactgtcccgtctgctcagcaaacagaatgaagaa
aacctgctgccgaaaaccatcctgtactgcctgaacccgcgtgataacgaagtgctgggc
accatgatcggtaacttccagggcgaaggcatgccgggcaagatgcagttcggttccggc
tggtggtttaacgaccagaaagacggcatgcagcgtcagatgacgcagctggcgcaactg
ggcctgctgagccgtttcgtcggcatgttgaccgacagccgcagtttcctgtcctacacc
cgtcatgaatacttccgccgcattctgtgccagatgatcggccgctgggtggaagatggc
gaagcgccgggcgacctgccgttgctgggcgagatggtgaaaaatatctgtttcgataac
gccaaaaactatttcggcatcgagttataccaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system