KEGG   Dickeya dadantii 3937: Dda3937_02748Help
Entry
Dda3937_02748     CDS       T01305                                 

Gene name
virB8
Definition
Inner membrane protein forms channel for type IV secretion of T-DNA complex (VirB8)
Orthology
K03203  
type IV secretion system protein VirB8
Organism
ddd  Dickeya dadantii 3937
Pathway
Bacterial secretion system
Class
Environmental Information Processing; Membrane transport; Bacterial secretion system [PATH:ddd03070]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3152959..3153642
Genome map
AA seq 227 aa AA seqDB search
MSETENLIASSRTFEAVLLEKDEREKKRAWRMAATGFALAALTITALIILLPLKTTDIEL
WSVDKQTGRYEYMTRLKEKDIATEAALAHALSAQYVRLREGYNYFALQRDYDDVQLFNSD
SVNRDYLDEFNGNQAPDVIFNKAEYVVSVEIISNIHAPATAPDHLATLRVKRIIRRIADN
TVKTDIWNIRLTYRYLPHKQLTDSQREVNPLGFIVTSYQRDKELRGE
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgtctgaaacagaaaacctcattgcgtcatcccgcacctttgaagcggttctgctggaa
aaggatgaacgggaaaaaaagcgcgcgtggcgcatggcggcaaccgggtttgcgctggcg
gcgctgacgataaccgcgctgattattctgctgccgctgaaaaccaccgacatcgaatta
tggtcggtggataaacagaccgggcgctatgaatacatgacccgtctcaaggagaaggat
atcgctaccgaagccgcgctggctcatgcgctatccgcccagtacgtccggctgcgcgaa
ggctataactattttgcgcttcagcgagattatgacgacgtgcagctcttcaacagcgac
agcgtgaaccgggattacctcgacgagtttaacggcaatcaggcccctgacgtcattttc
aataaagcggaatacgtcgtgtctgtcgagattatttccaacattcacgcccccgccacc
gcccctgaccacctggcaaccttgcgagttaaacgcataatccgccgcattgcggataac
acggtcaaaacggatatctggaacatccgcctgacttaccgctacctcccccacaaacaa
ctgaccgacagccagcgagaagtgaacccattggggttcatcgtcaccagctaccagcgc
gataaagaactgaggggggaatga

DBGET integrated database retrieval system