KEGG   Dickeya dadantii 3937: Dda3937_02793Help
Entry
Dda3937_02793     CDS       T01305                                 

Gene name
cel5Z
Definition
endo-1,4-beta-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ddd  Dickeya dadantii 3937
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Dda3937_02793 (cel5Z)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Dda3937_02793 (cel5Z)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3098146..3099426
Genome map
AA seq 426 aa AA seqDB search
MPLSYLDKNPVIDSKKHALRKKLFLSCAYFGLSLACLSSNAWASVEPLSVNGNKIYAGEK
AKSFAGNSLFWSNNGWGGEKFYTADTVASLKKDWKSSIVRAAMGVQESGGYLQDPAGNKA
KVERVVDAAIANDMYAIIGWHSHSAENNRSEAIRFFQEMARKYGNKPNVIYEIYNEPLQV
SWSNTIKPYAEAVISAIRAIDPDNLIIVGTPSWSQNVDEASRDPINAKNIAYTLHFYAGT
HGESLRNKARQALNNGIALFVTEWGTVNADGNGGVNQTETDAWVTFMRDNNISNANWALN
DKNEGASTYYPDSKNLTESGKKVKSIIQSWPYKAGSAASATTDPSTDTTTDTTVDEPTTT
DTPATADCANANVYPNWVSKDWAGGQPTHNEAGQSIVYKGNLYTANWYTASVPGSDSSWT
QVGSCN
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgccgctctcttatttggataagaatccagtcatcgatagcaaaaaacacgccctacgt
aaaaaattgtttttatcttgtgcctattttggattaagccttgcctgtctttccagtaat
gcctgggcgagcgttgaaccgttatccgttaacggtaataaaatctacgcaggtgaaaaa
gccaaaagttttgccggcaacagcctattctggagtaataatggctggggcggagaaaaa
ttctatacagccgataccgttgcatcgctgaaaaaagactggaaatccagcattgttcgc
gccgctatgggcgttcaggaaagcggtggttatctgcaggacccggctggcaacaaggcc
aaagttgaaagagtggtggatgccgcaatcgccaacgatatgtatgcgattattggctgg
cactcgcattctgcagaaaacaatcgcagtgaagccattcgtttctttcaggaaatggcg
cgcaaatatggcaacaagccgaatgtcatttatgaaatctacaacgaaccgcttcaggtt
tcatggagcaataccattaaaccttatgccgaagccgtaatttccgccattcgcgccatt
gacccggataacctgattattgtcggtacgcccagttggtcgcaaaacgttgatgaagcg
tcgcgcgatccaatcaacgccaagaatatcgcctatacgctgcatttctacgcgggaacc
catggtgagtcattacgcaataaagcccgccaggcgttaaataacggtattgcgcttttc
gtcaccgagtggggcaccgttaacgcggacggcaatggcggagtgaaccagacagaaacc
gacgcctgggtaacgttcatgcgtgacaacaacatcagcaacgcaaactgggcgttgaat
gataaaaacgaaggggcatcaacctattatccggactctaaaaacctgaccgagtcgggt
aaaaaagtaaaatcgatcattcaaagctggccatataaagcgggcagcgccgccagtgca
acaaccgatccgtcaaccgataccaccactgacaccaccgttgacgaaccgaccacaacc
gacacaccggcaaccgctgattgcgccaatgccaacgtttaccccaactgggttagcaaa
gactgggcgggcgggcagcctactcataacgaagcaggccaatcgatcgtctacaaaggc
aacctgtataccgcaaactggtacaccgcatccgttccgggcagcgattcctcctggacg
caggttggtagctgtaactaa

DBGET integrated database retrieval system