KEGG   Dickeya dadantii 3937: Dda3937_02949Help
Entry
Dda3937_02949     CDS       T01305                                 

Gene name
recD
Definition
exonuclease V (RecBCD complex) subunit alpha
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
ddd  Dickeya dadantii 3937
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ddd03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2498288..2500333)
Genome map
AA seq 681 aa AA seqDB search
MNITRYDELTLLLDQWVECGWLRELDRALVRFLHQECPEASSLLLLGAALVSYQLGRGHV
CLDLDATLADSGFSLALPPEGDRSENRKIARPAEVLAGVTLSAWQAALQQPQLVSSGEGS
TPLVLVGARLYLRRYWRYEQDVRHAITQQLTQNDALRAAITPAALRQRLDALFPAAAAGS
ANWQKLACALAAGSAFSIITGGPGTGKTTTVVKLLALLQSLALEQHGKPLRIRLAAPTGK
AAARLNESIAGAIAGLTLDGLAQGEAIREQINSEVVTLHRLLGSRPDTRHFRHHADNPLM
LDVLVVDEASMVDLEMMAALLAAMPARSRLILLGDKDQLASVEAGALMGELCQRAAQGHY
LPQTRDWLREVAGDAPDDSLLDPQGSALDQSIAMLRHSYRFGADSGIGQLAEAVNAGDAA
ALASVWRQGYADLARLTLTANDNRALREWVIDGAADRFGAQPAAAAPVGYGDYLRRMAST
RPALTAPQSEFDMWAAQILDAFGQFQLLCALRNGPWGVDSMNERIAQLLYRDGLLAAWQG
WYPGRPVMVTRNDYSQRLMNGDIGITLQVPLLQPDGSWGWATRVAFPAGDGSSGIRWVLP
GRLSAVETVFAMTVHKSQGSEFAHTALLLPDSLSPILTRELVYTGITRAKHAFSLGCVGE
HSTVLAEAVGRRVLRVSGLVE
NT seq 2046 nt NT seq  +upstreamnt  +downstreamnt
atgaacataacccgttatgacgaattaaccctgttgctggaccagtgggttgagtgcggc
tggttgcgggagctggatcgggcgttggtgcgctttctgcatcaagagtgcccggaggcg
tcgtccttgttgctgctgggcgcggcgctggtcagctatcagcttgggcgcgggcatgtg
tgcctcgatctggacgccacgcttgccgacagcgggttttcgctggcgctgccgccggaa
ggcgatcgcagtgaaaatcgtaagattgcgcgcccggcggaggttctggcgggcgttacc
ctgtcggcctggcaggcggcgttgcaacagccgcaactggtatcgtcgggggaaggcagc
acgccgctggtgctggtcggcgcgcgtctgtatctgcgccgttactggcgatacgagcag
gatgtgcgccacgccattacgcagcaactgacacaaaacgacgcgctgcgggcggcgata
acgccagcggcgctgcgccagcggttggatgcgctgtttcctgccgccgcggccggctcc
gccaactggcagaaactggcctgcgcgctggcggcgggcagtgctttcagcatcatcacc
ggcgggccgggcaccggaaaaaccaccaccgtggtgaaactgctggcgctgttgcagtcg
ctggcgctggaacagcacggtaagccgttgcggattcggctggcggcgcccaccggcaag
gcggcggcccgcctgaacgagtcgattgccggggccattgccggcctgacgctggatggg
ctggcgcagggcgaggctatccgggaacagatcaacagcgaggtggtgaccctgcaccgg
ttgctgggcagccggccggatacccggcatttccgtcatcacgccgataatccgctgatg
ctggatgtgctggtggtggatgaagcgtcgatggtggatctggagatgatggcggcgctg
ctggcggcgatgccggcccggtcccgcctgattctgctgggcgataaagatcaactggcg
tcggtggaagccggcgccttgatgggcgaactgtgccagcgcgccgcacaagggcattac
ctgccgcagacccgcgactggttacgcgaggtggcgggggacgcgccggacgattcgctg
ctcgacccgcaaggcagcgcgctggatcaatccatcgccatgctgcgtcacagctaccgc
tttggcgctgacagcggcatcggccaactggcggaggcggtgaacgccggcgatgcggcg
gcgttggcgtctgtctggcggcaggggtatgccgacctggcgcgcctgacgttgacggcg
aatgataaccgcgcgctgcgtgaatgggttattgacggcgccgccgatcggttcggcgct
cagcctgctgcggcggcaccggtgggctacggcgactacctgagacggatggcctcgaca
cggccggcgctgacggcgccgcaaagcgagttcgacatgtgggcggcgcagattctggac
gccttcggccagttccaactgctatgcgcgttgcgcaacgggccgtggggcgtcgacagt
atgaatgagcgcatcgcccaactgctgtatcgggacggcttgctggcggcctggcaaggc
tggtatccggggcggccggtgatggtgacccgcaacgattatagccagcggctgatgaac
ggcgatatcggcatcaccctacaggtgccgctgctccagccggacggctcatgggggtgg
gcgaccagggtggcgtttccggccggcgatggctcatcgggtatccgctgggtgctgccg
gggcgactgtccgcggtggaaacggtgttcgccatgacggtgcacaaatcccaggggtcg
gaattcgcccacaccgccttgctgctgccggattctttaagcccgatcctgacccgcgaa
ctggtgtacaccggtattacccgcgccaaacacgcgttcagcctcggctgcgtgggggag
cacagcacggtgctggcggaggcggtcggccggcgggtgttgcgggtaagcggactggtg
gaataa

DBGET integrated database retrieval system