KEGG   Dickeya dadantii 3937: Dda3937_02973Help
Entry
Dda3937_02973     CDS       T01305                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ddd  Dickeya dadantii 3937
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Dda3937_02973 (hisD)
  Amino acid metabolism
   00340 Histidine metabolism
    Dda3937_02973 (hisD)
Enzymes [BR:ddd01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     Dda3937_02973 (hisD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2196724..2198034)
Genome map
AA seq 436 aa AA seqDB search
MSNRFNTLIDWQACTEAEQRQLLTRPAISASDRISAIVSEILAKVRDDGDAALREYSARF
DKVQVDSLRVSAEAIDAAAARLGDDIKQAMATAVRNIETFHNAQKLPSISVETQPGVRCQ
QVTRPIASVGLYIPGGSAPLLSTVLMLATPARIAGCRRVILCSPPPIADEILYAAKLCGV
QEVFQLGGAQAIAAMAFGTDSVPKVDKIFGPGNAYVTEAKRQVSQLLDGAAIDMPAGPSE
VLVIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAQAVIEAVERQLTTLSRADIA
RQALASSRVIVARDLDQCIDISNQYGPEHLIIQTRDAEALVERITSAGSVFLGDWSPESA
GDYASGTNHVLPTYGYTATYSSLGLADFQKRMTVQQLSPQGLLGLASTIEIMAQAEQLTA
HKNAVTLRVNALKEQA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccgcttcaacaccctaattgactggcaggcctgcaccgaagcagagcagcgt
cagttgctcacccgtccggctatctccgcgtccgatcgcatcagcgcgattgtcagcgag
attctggcaaaggtacgggatgacggcgatgccgcgctacgcgagtacagcgcccgcttt
gacaaggtgcaggtcgatagcctgcgcgtatccgccgaggcaattgacgccgccgccgca
cgactgggcgacgacatcaaacaggcgatggcgaccgccgtgcgcaacatcgaaaccttt
cataacgcgcagaagctcccatcgatcagcgtagaaactcagccgggagtgcgttgccaa
caggtaacccggccgatcgccagcgtagggttgtatattcctggcggctccgccccgctg
ctttccaccgtgctgatgctggcgaccccggcgcgcatcgccgggtgccggcgcgtgatt
ctgtgctcgccgccgccgatcgctgacgagatcctgtatgcggcaaaactgtgcggcgtg
caggaagtgttccaactgggcggcgcacaggcgattgccgcaatggcgttcggcaccgac
agcgtgccaaaggtggataagattttcggccccggcaacgcctatgtgaccgaagccaag
cgtcaggttagccagttgctagacggcgcggccatcgatatgccggccggtccgtccgaa
gtgctggtgatcgccgacagcggcgccacgccggattttgtcgcctccgacctgctgtcg
caggcagagcacggcccggattcgcaggttatcctgctgacgccggatgccgacatggcg
caggcggtaatagaggcggtagaacgtcagttgaccacattgtctcgcgcagacatcgcc
cgtcaggcgctggccagcagccgggtgatcgtggcgcgcgatctggaccagtgcatcgac
atcagcaatcaatacggcccggaacacctgattatccagacccgcgatgccgaagccctg
gtcgagcgtatcaccagcgccggttcggtatttttgggtgactggtcaccggaatccgcc
ggcgattacgcgtccggcaccaaccatgtgctgccgacctacggttacaccgccacctac
tccagtctggggctggcggatttccagaaacgcatgacggtacagcagttgtcgccgcaa
ggtttgctggggctggcgtcaaccattgaaatcatggcgcaggccgaacagctgaccgcc
cacaaaaacgccgtcaccctgcgcgtcaacgccctcaaggagcaagcatga

DBGET integrated database retrieval system