KEGG   Dickeya dadantii 3937: Dda3937_02973Help
Entry
Dda3937_02973     CDS       T01305                                 

Gene name
hisD
Definition
bifunctional histidinal dehydrogenase/histidinol dehydrogenase
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ddd  Dickeya dadantii 3937
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:ddd01230]
Metabolism; Amino acid metabolism; Histidine metabolism [PATH:ddd00340]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2196724..2198034)
Genome map
AA seq 436 aa AA seqDB search
MSNRFNTLIDWQACTEAEQRQLLTRPAISASDRISAIVSEILAKVRDDGDAALREYSARF
DKVQVDSLRVSAEAIDAAAARLGDDIKQAMATAVRNIETFHNAQKLPSISVETQPGVRCQ
QVTRPIASVGLYIPGGSAPLLSTVLMLATPARIAGCRRVILCSPPPIADEILYAAKLCGV
QEVFQLGGAQAIAAMAFGTDSVPKVDKIFGPGNAYVTEAKRQVSQLLDGAAIDMPAGPSE
VLVIADSGATPDFVASDLLSQAEHGPDSQVILLTPDADMAQAVIEAVERQLTTLSRADIA
RQALASSRVIVARDLDQCIDISNQYGPEHLIIQTRDAEALVERITSAGSVFLGDWSPESA
GDYASGTNHVLPTYGYTATYSSLGLADFQKRMTVQQLSPQGLLGLASTIEIMAQAEQLTA
HKNAVTLRVNALKEQA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaccgcttcaacaccctaattgactggcaggcctgcaccgaagcagagcagcgt
cagttgctcacccgtccggctatctccgcgtccgatcgcatcagcgcgattgtcagcgag
attctggcaaaggtacgggatgacggcgatgccgcgctacgcgagtacagcgcccgcttt
gacaaggtgcaggtcgatagcctgcgcgtatccgccgaggcaattgacgccgccgccgca
cgactgggcgacgacatcaaacaggcgatggcgaccgccgtgcgcaacatcgaaaccttt
cataacgcgcagaagctcccatcgatcagcgtagaaactcagccgggagtgcgttgccaa
caggtaacccggccgatcgccagcgtagggttgtatattcctggcggctccgccccgctg
ctttccaccgtgctgatgctggcgaccccggcgcgcatcgccgggtgccggcgcgtgatt
ctgtgctcgccgccgccgatcgctgacgagatcctgtatgcggcaaaactgtgcggcgtg
caggaagtgttccaactgggcggcgcacaggcgattgccgcaatggcgttcggcaccgac
agcgtgccaaaggtggataagattttcggccccggcaacgcctatgtgaccgaagccaag
cgtcaggttagccagttgctagacggcgcggccatcgatatgccggccggtccgtccgaa
gtgctggtgatcgccgacagcggcgccacgccggattttgtcgcctccgacctgctgtcg
caggcagagcacggcccggattcgcaggttatcctgctgacgccggatgccgacatggcg
caggcggtaatagaggcggtagaacgtcagttgaccacattgtctcgcgcagacatcgcc
cgtcaggcgctggccagcagccgggtgatcgtggcgcgcgatctggaccagtgcatcgac
atcagcaatcaatacggcccggaacacctgattatccagacccgcgatgccgaagccctg
gtcgagcgtatcaccagcgccggttcggtatttttgggtgactggtcaccggaatccgcc
ggcgattacgcgtccggcaccaaccatgtgctgccgacctacggttacaccgccacctac
tccagtctggggctggcggatttccagaaacgcatgacggtacagcagttgtcgccgcaa
ggtttgctggggctggcgtcaaccattgaaatcatggcgcaggccgaacagctgaccgcc
cacaaaaacgccgtcaccctgcgcgtcaacgccctcaaggagcaagcatga

DBGET integrated database retrieval system