KEGG   Dickeya dadantii 3937: Dda3937_03029Help
Entry
Dda3937_03029     CDS       T01305                                 

Gene name
rafA
Definition
alpha-galactosidase
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ddd  Dickeya dadantii 3937
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Dda3937_03029 (rafA)
  Lipid metabolism
   00561 Glycerolipid metabolism
    Dda3937_03029 (rafA)
   00600 Sphingolipid metabolism
    Dda3937_03029 (rafA)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Dda3937_03029 (rafA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1782196..1784325
Genome map
AA seq 709 aa AA seqDB search
METTLIRLASPATDVIVRCRPAAEILYWGPHLAAFSPQDADSLSRPVANGRLDVDVPVTL
AAETGRGLFGSPGIEGHRNGLDAFAVLTTVAVRQPDPQQLVIEAEDRQAGLRLTTELRLH
ADSGVLQLRHCLTNLHPGDWQVQRLAVTLPLPESAAEVMAFHGRWVREFQPHRTLLSHGS
LVQENRRGRTSHEYFPAMISGEPGFAEQHGRVWGAHLGWSGNHRLRTEVKTDGRRLLQAE
ALYLPGEIALAQGESLTTPWLYAACSEQGLNGMSQQFHRFLRQEIIRFPRAKARPVHLNT
WEGIYFKHDPDYIMQMASQAAALGVERFIIDDGWFRGRDHDRAALGDWYVDPRKYPQGLM
PVINHVRELGMEFGIWVEPEMINPDSDLYRAHPDWLLALPGYDQPTGRYQYVLDLSNPEV
FDYLLARLSWLLGGHPIDYVKWDMNRELVQPAHQGRAAADRQTQAFYRLLDVLGERFPQV
EFESCASGGGRIDYEVLRRCHRFWASDNNDALERQTIQRGMSYFFPPEVMGAHIGHHRCH
ATGRQHSIAFRGLTALFGHMGIELDPVRADAQEQAGFRHYVALHRRYRALLHTGCLWRVD
MPDATTQVQGVISADRGQALFLVAQLAMPDYALAGVLRFPGLDPQARYRLTVVDHPDLKP
VVDGGSTMRQLPAWMAAPAEYSSEWLMKAGLRLPILNPETALLLALERL
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggaaacgacgctgattcgtctcgccagtccggcgacggatgtcattgtgcgctgccgg
ccggcagcggaaatactttactgggggccgcatctggcggcattttcgccgcaggatgcg
gacagcctgtcgcggccggtggcgaacggccggctggatgtggacgtgccggtgacgctg
gcggcggaaaccggacgcgggctgttcggctcgccgggcattgaggggcatcgcaacggt
ctcgatgcctttgcggtgctgaccaccgtcgcggtgcgtcagccggacccgcagcaactg
gtcatcgaggcggaagaccgtcaggctggcctgcgcctgaccaccgagttacggctgcat
gccgacagcggggtgctgcaactgcgccactgcctgaccaatctgcatccgggcgactgg
caggtgcagcggctggcggtcacgttaccgttaccggagtcggcggcggaggtgatggcg
tttcacggccgctgggtgcgggaatttcagccgcatcgcacgctgctgtcgcacggcagt
ctggtgcaggaaaaccgccgcgggcgcacgtcgcacgaatattttccggcgatgatcagc
ggggaaccgggatttgccgaacagcacggtcgggtgtggggcgcgcacctcggctggagc
ggcaaccaccggttgcgcacggaggtgaagaccgacggccggcggctgttgcaggcggag
gcgctttacctgcccggcgaaatcgcgctggcgcagggggagtcgctgaccacgccgtgg
ctgtacgccgcctgttctgaacaggggctgaacggcatgagccagcagtttcaccggttt
ctgcgtcaggagattatccgttttccgcgtgccaaggcgcgcccggttcacctcaatacc
tgggaaggcatctactttaagcatgacccggactacatcatgcagatggcgagccaggcg
gcggcgctgggcgtcgagcgctttattatcgacgatggctggtttcgcgggcgcgaccat
gaccgcgccgcgctgggcgactggtatgtggacccgcgcaagtacccgcaggggctgatg
ccggtgataaaccatgtgcgggagctgggcatggaattcggcatttgggtagaaccggaa
atgatcaacccggactccgacctctatcgcgcgcacccggactggctgctggcgctgccc
ggctacgaccagccgaccggccgctaccagtacgtgctcgacctgtctaaccccgaggtg
ttcgattatctactggcgcgcctgagctggctgttgggcgggcaccccatcgattacgtg
aaatgggacatgaaccgggagctggtgcagccggcccatcaggggcgggcggcggctgac
cgccagacgcaggcgttttaccgcctgctcgacgtgctgggcgagcgctttccgcaggtg
gagtttgagtcctgcgcatccggtggcgggcgcattgattatgaagtgttgcggcgttgc
caccgtttctgggcgtctgacaacaacgacgcgctggagcggcagacgattcagcgcggc
atgagctacttcttcccgcccgaagtgatgggggcgcacatcggccatcaccgctgtcac
gccaccggacgccagcacagtattgcctttcgcgggttgacggcgctgttcggtcatatg
ggtatcgagctggatccggtgcgcgccgatgcgcaggaacaggccggttttcgccattat
gtggcgttgcatcggcgttaccgcgcgctgttgcacaccggttgcctgtggcgggtcgac
atgccggacgccaccacccaggtgcagggggtgatcagtgccgatcgggggcaggcgctg
tttctggtagcgcagttggcgatgccggattacgcgctggccggggtgctgcgattcccc
ggtctggacccgcaggcccgttaccggttgaccgtggtggatcatcccgacctgaagccg
gttgtcgacggcggcagcaccatgcgccagctgccggcatggatggcggcaccggctgaa
tacagcagcgaatggctgatgaaagccgggctgcgtctgcccattctcaacccggaaacg
gcgctgttgctggcgttagaacgtctgtaa

DBGET integrated database retrieval system