KEGG   Dickeya dadantii 3937: Dda3937_03086Help
Entry
Dda3937_03086     CDS       T01305                                 

Definition
extracellular solute-binding protein
Orthology
K15495  
molybdate/tungstate transport system substrate-binding protein
Organism
ddd  Dickeya dadantii 3937
Pathway
ABC transporters
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:ddd02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4051090..4052025)
Genome map
AA seq 311 aa AA seqDB search
MNIRVRYQFAVVLAAALFTGSAAQAQDKIQLTYAGSMGVVMDKALGPTFAQKENLSYQGQ
GQGAYGMARLLASKKVVADVFVSITPGPMQILKDAGLIDDAIPVASTRMVIAYNPKSPFA
ARLAVSDKAKNSDWLSVLQDKSLKFGRTDPYNDPQGQNIVFTMLLAEKYYHQPDAAKKAL
GEVQNPAQVFMEGGLLTRLESGQIDATSGYESAVRSAKLPYVSLPDEINLSNPAMSKQWY
DTVSFTIKDSAGKDQVLHTQPLVFYAAVLKNAPDAAQARKFVNFMLSPEGQALFRQNGYD
VPKGGTLYAAK
NT seq 936 nt NT seq  +upstreamnt  +downstreamnt
gtgaacattcgggttaggtatcaattcgccgtcgtgttggcggcggcattattcacgggc
agcgcggcacaagcgcaggataaaattcagttaacctacgccgggtcgatgggcgtggtg
atggacaaggcgttggggccgacgttcgcccaaaaagagaacctgagctatcaggggcag
ggccaaggggcgtacggcatggcgcgcctgctggccagcaagaaagtggtggcggatgta
ttcgtgtccatcacgccggggccgatgcagatactgaaagacgccggactgatcgacgac
gctattccggtcgccagtacccgtatggtcatcgcctacaatccgaaaagcccgtttgcc
gccagactggcggtgtccgataaggcgaagaatagcgactggctgagcgtgttgcaggat
aaatcgctgaaattcggccgcaccgacccgtataacgacccgcagggccagaatatcgtc
ttcaccatgctgctggccgagaagtactatcatcagccggatgcggccaaaaaggcgctg
ggcgaggtgcagaacccggcgcaggtgtttatggaaggcgggctgctgacccggctggag
tccgggcagatcgacgccacctccggttacgagagcgcggtgcgctccgccaaactgccg
tatgtgtcgctgccggatgaaatcaacctcagcaacccggcgatgtcgaaacagtggtac
gacaccgtcagcttcaccatcaaagacagcgccggcaaggatcaggtgctgcacacccag
ccgctggtgttctacgccgcggtgctgaaaaacgcgcccgatgcggcgcaggcccgcaaa
ttcgtcaactttatgctcagcccggaagggcaggcgctgttccgccagaacggctatgac
gtaccgaaaggcggtacgctctacgccgcgaagtaa

DBGET integrated database retrieval system