KEGG   Dickeya dadantii 3937: Dda3937_03097Help
Entry
Dda3937_03097     CDS       T01305                                 

Gene name
aceF
Definition
(GenBank) pyruvate dehydrogenase, dihydrolipoyltransacetylase component E2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
ddd  Dickeya dadantii 3937
Pathway
ddd00010  Glycolysis / Gluconeogenesis
ddd00020  Citrate cycle (TCA cycle)
ddd00620  Pyruvate metabolism
ddd01100  Metabolic pathways
ddd01110  Biosynthesis of secondary metabolites
ddd01120  Microbial metabolism in diverse environments
ddd01130  Biosynthesis of antibiotics
ddd01200  Carbon metabolism
Module
ddd_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Dda3937_03097 (aceF)
   00020 Citrate cycle (TCA cycle)
    Dda3937_03097 (aceF)
   00620 Pyruvate metabolism
    Dda3937_03097 (aceF)
Enzymes [BR:ddd01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     Dda3937_03097 (aceF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Biotin_lipoyl_2 RnfC_N GCV_H HlyD_D23 NQRA
Motif
Other DBs
NCBI-ProteinID: ADN00019
UniProt: E0SG51
Position
complement(4088904..4090790)
Genome map
AA seq 628 aa AA seqDB search
MAIEINVPDIGADEVEVTEVLVKVGDKVEAEQSLITVEGDKASMEVPSPQAGVVKEIKVA
VGDKVATGKLIMVFEAEGAATAAPAPAAAASAPAAAPAAASAVKEVAVPDIGGDEVEVTE
VMVKVGDSVSAEQSLITVEGDKASMEVPAPFAGVVKEIKINTGDKVKTGSLIMVFEVAGA
AGAAAPAQQAAPAAAPAAAASGPKDVNVPDIGGDEVEVTEVMVKVGDKIAAEQSLITVEG
DKASMEVPAPFAGTVKEIKISTGDKVKTGSLIMVFEVEGAAPAAAAAPAAATAAPVASAP
AAAPAPAAAKADSKGEFTENDAYIHATPVIRRLAREFGVNLAKVKGTGRKGRILREDVQA
YVKDAVKRAESAPAAAAGGGLPGMLPWPKVDFSKFGEVEEVELGRIQKISGANLSRNWVM
IPHVTHFDKTDITDLEAFRKQQNVEAEKRKLDVKITPVVFIMKAVAAALEQMPRFNSSLS
EDAQRLTLKKYINIGVAVDTPNGLVVPVFKDVNKKGIIELSRELMTISKKARDGKLTAGE
MQGGCFTISSIGGLGTTHFAPIVNAPEVAILGVSKSAMEPVWNGKEFTPRLMMPISLSFD
HRVIDGADGARFITIINNTLSDIRRLVM
NT seq 1887 nt NT seq  +upstreamnt  +downstreamnt
atggctatcgaaatcaacgtaccggatatcggtgcagatgaagttgaagtcaccgaagtg
ctggtcaaagtgggtgacaaagtggaagccgagcagtcgctgattaccgttgaaggcgac
aaggcgtccatggaagttccctcaccgcaagccggtgtggtcaaagagattaaagtggcg
gtgggcgacaaggttgcaaccggcaaactgatcatggtctttgaagctgaaggtgcggca
actgccgcaccggctccggctgctgctgcgtcggcgcctgccgcggccccggccgccgcc
agcgcggtcaaagaagtcgcagtgccggacatcggcggcgacgaagttgaagtcaccgaa
gtcatggtgaaagtgggcgacagcgtgagcgctgagcagtcactgatcactgtggaaggc
gacaaggcttctatggaagtgccggcgccgttcgcaggcgtggtgaaagagatcaagatc
aacaccggtgacaaagtgaaaaccggctcgctgatcatggtgtttgaagtcgcaggtgcc
gccggcgctgcggctccggcccagcaagcggccccggctgcggcacccgccgctgcggcg
tctggtccgaaagacgttaacgtaccggatatcggtggcgacgaagttgaagtcactgaa
gtcatggtcaaagtgggcgacaaaattgccgctgaacaatctctgatcaccgtagaaggc
gataaagcctctatggaagttccggcaccgttcgcgggcaccgtgaaagagatcaagatc
agcaccggcgataaagtgaaaaccggctcgctgatcatggtcttcgaagtggaaggtgcc
gcgccggcagcggctgcagctccagccgctgcgacagcagctccggtcgccagcgcgcct
gcggcagcgccggctccggctgcggcgaaagccgacagcaagggcgagttcaccgagaac
gacgcttacattcacgctaccccggttatccgtcgtttggcgcgtgagtttggcgtcaac
ctggcgaaagtgaaaggcaccggtcgtaaaggtcgtatcctgcgcgaagacgttcaggct
tacgtgaaagacgcggtcaaacgcgctgagtccgcgcctgccgctgctgctggcggcggt
ctgccgggcatgctgccgtggccgaaagtcgacttcagcaagttcggcgaagtcgaagaa
gtggaactgggccgcatccagaagatctctggcgcgaacctgagccgtaactgggtgatg
atcccgcacgttacgcacttcgacaaaaccgacatcaccgatctggaagcgttccgtaaa
cagcagaacgtggaagcagagaagcgcaaactggacgtgaagatcaccccggttgtgttc
atcatgaaagccgttgccgctgcgcttgagcagatgccgcgtttcaacagttcgctgtct
gaagatgcccaacgtctgacgctgaagaaatacatcaacatcggtgtagcggttgatacc
ccgaatggtttggtggttccggtgttcaaagatgttaacaagaaaggcatcatcgagctg
tctcgtgaactgatgactatctctaagaaagcccgtgacggtaagttgaccgccggcgaa
atgcagggcggatgcttcactatctccagcatcggcggcctcggtaccactcacttcgcg
ccgattgtcaacgcgccggaagtggctatcctgggtgtgtctaagtccgccatggaaccg
gtctggaatggtaaagagtttactccgcgtctgatgatgccgatctctctgtccttcgac
caccgtgtcattgacggtgctgatggtgcgcgcttcattaccatcatcaacaacacgttg
tctgacattcgccgtctggtgatgtaa

DBGET integrated database retrieval system