KEGG   Dickeya dadantii 3937: Dda3937_03265Help
Entry
Dda3937_03265     CDS       T01305                                 

Gene name
mutM
Definition
formamidopyrimidine/5-formyluracil/5-hydroxymethyluracil DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
ddd  Dickeya dadantii 3937
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:ddd03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4667872..4668681)
Genome map
AA seq 269 aa AA seqDB search
MPELPEVETSRRGISPWLVGHTILYAEVRNARLRWPVSPEILSLSDTPVLSVQRRAKYLL
IELPTGWIIVHLGMSGSLRVLPEYSEPDKHDHVDLVMDSGKVLRYTDPRRFGAWLWCDDP
ATSSVLAHLGPEPLSDDFSGRYLFAQSRGRKTPIKLWIMDNKLVVGVGNIYASESLFNAG
VLPNRPAGSLSEVEADQLVRSIKQVLQRSIEQGGTTLRDFLQSDGKPGYFAQELQVYGRS
GEPCHHCGTPIESIKQGQRSTFFCKCCQR
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgccagaattacccgaagtggaaaccagtcgccggggcatttcaccctggctggtcggc
cataccattctgtatgccgaggtgcgtaacgcgcgcctgcgctggcctgtctctcctgaa
atcctatcgctgagcgatacgccggtgctgagtgtgcagcggcgggccaaatatctgctg
attgaactgccgaccggctggataatcgtacatctgggtatgtcgggcagtttgcgggtg
ctgccggaatacagcgagccggataagcatgaccacgtcgatctggtgatggacagcggt
aaggtgctgcgttataccgacccgcgtcgtttcggcgcctggctgtggtgcgacgatccg
gcgaccagttcggtgctggcgcatctggggccggaaccgctgagcgacgatttttccggt
cgctacctgtttgcccaatcccgcggccgcaaaacgccgatcaagctgtggattatggac
aacaaactggtggtgggcgtgggcaacatctacgccagtgaatcgctgtttaatgctggt
gttctgccgaaccgaccggcgggttcgttgtctgaggttgaagcggaccaactggtacgt
tccatcaaacaggtattgcaacgctcgattgagcaaggcggcaccacactgcgggatttc
ctgcagtccgatggcaaaccgggttatttcgcgcaggagttacaggtctatggccgaagc
ggcgagccctgtcaccattgcggcacgccgattgagagtatcaagcagggtcagcgcagt
acttttttctgtaaatgttgtcagcgttaa

DBGET integrated database retrieval system