KEGG   Dickeya dadantii 3937: Dda3937_03270Help
Entry
Dda3937_03270     CDS       T01305                                 

Gene name
galF
Definition
regulatory subunit of UTP--glucose-1-phosphate uridylyltransferase, with GalU
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ddd  Dickeya dadantii 3937
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dda3937_03270 (galF)
   00052 Galactose metabolism
    Dda3937_03270 (galF)
   00500 Starch and sucrose metabolism
    Dda3937_03270 (galF)
   00520 Amino sugar and nucleotide sugar metabolism
    Dda3937_03270 (galF)
Enzymes [BR:ddd01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Dda3937_03270 (galF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1520721..1521617
Genome map
AA seq 298 aa AA seqDB search
MTALKAIIPVAGLGMNLLPVTKAIPKEMLPLVDRPVIEKIVNECVNAGIKEIVLVTHASK
NAIENHFDTSFELESMLEERAKRQLLAEVQSICPPGVTIMNVRQGQTLGLGHAVSCAHPI
VGNSPFVVVLPDVVMDDASADQSKDNLALLISRFKETGHSQVLVKHRPYEVLPEYSIVEC
ENALNQAGDASAITSMIEKPELAPVEGSDLSAVGRYVLTAEAWPILENTLAGAWGRIQLT
DAIAELIKTQQVDAVQMAGRSFNCGRKMGYVQAFVSYGLRHPELGSAFKTKIKALLSK
NT seq 897 nt NT seq  +upstreamnt  +downstreamnt
atgacagcattaaaagcgattatccccgttgccggtttagggatgaacttgttaccggtt
accaaagcgattccaaaagagatgcttccgttggttgaccggccggtgatcgaaaagatt
gtcaacgagtgcgtcaatgcggggattaaagagatcgtgctggtgacgcacgcctctaaa
aacgccattgaaaaccattttgatacctctttcgagctggagtcgatgctggaagagcgc
gccaagcgtcagttgctggcggaggttcagtccatttgcccgccgggcgtgaccatcatg
aatgtgcgtcaggggcagacgctgggcctggggcacgccgtgtcctgcgcccatccgatc
gtcggcaactcgccgtttgtggtggtgctgccggatgtggtgatggacgacgcttccgcc
gatcagtcgaaagacaatctggcgctgctgatctcccgttttaaagaaaccggtcacagc
caggtactggtaaaacaccgtccttacgaggtgctgccggaatattccatcgtggaatgt
gagaacgcgttgaatcaggcgggcgacgcgtcggcgatcacgtcgatgatcgagaaaccg
gaactggcgccggtggaaggttcggacctgtccgcggtcggacgttatgttctgactgcc
gaagcctggccgattctggaaaacaccctggcgggcgcgtggggtcgtatccaactgacc
gatgccatcgctgagctgatcaaaacccagcaggttgatgccgttcagatggcggggcgc
agcttcaactgcggccgtaagatggggtacgtgcaggcattcgtgtcctacggcctgcgc
catccggaactgggcagcgctttcaaaaccaaaatcaaggcgctgctgagcaaataa

DBGET integrated database retrieval system