KEGG   Dickeya dadantii 3937: Dda3937_03289Help
Entry
Dda3937_03289     CDS       T01305                                 

Gene name
recR
Definition
gap repair protein
Orthology
K06187  
recombination protein RecR
Organism
ddd  Dickeya dadantii 3937
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Dda3937_03289 (recR)
DNA repair and recombination proteins [BR:ddd03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Dda3937_03289 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1293859..1294464
Genome map
AA seq 201 aa AA seqDB search
MQTSPLLESLMEALRCLPGVGPKSAQRMAFHLLQRDRSGGMRLAQALTRAMSEIGHCADC
RTFTEQDICTICANPRRQQNGQICVVESPADIHAIEQTGQFAGRYFVLMGHLSPLDGIGP
GDIGLDRLEERLATETISEVILATNPTVEGDATANYIAELCAENGVMASRIAHGVPVGGE
LEMVDGTTLSHSLAGRHPIRF
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaccagcccgcttcttgaatcgctgatggaggcgctgcgctgtttacccggcgtg
gggccaaaatcggcgcagcgcatggcgtttcacctgttgcagcgcgatcgcagcggcggt
atgcgtctggcgcaggcgctgacccgtgctatgtcggagatcggccactgcgccgactgc
cggacctttaccgagcaggatatctgcactatctgcgccaatccgcgccgtcagcagaac
ggccagatttgcgtggtggaaagcccggcggatattcacgccatcgagcagaccgggcag
ttcgccggccgctactttgtgctgatggggcatctgtcgccgctggatggcatcggtccc
ggcgatatcgggctggatcggctggaagagcgtctggcgacggaaaccatcagtgaagtg
attctggcgaccaacccgacggtggaaggcgatgcaacggctaattacatcgccgagttg
tgcgccgaaaacggggtaatggccagccgtatcgctcacggcgtgccggttggcggcgag
ctggagatggtggacggcaccacgctgtctcattcgctggccgggcgacacccgatccgc
ttctga

DBGET integrated database retrieval system