KEGG   Dickeya dadantii 3937: Dda3937_03351Help
Entry
Dda3937_03351     CDS       T01305                                 

Gene name
pflA
Definition
pyruvate formate lyase activating enzyme 1
Orthology
K04069  
pyruvate formate lyase activating enzyme [EC:1.97.1.4]
Organism
ddd  Dickeya dadantii 3937
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2176294..2177034)
Genome map
AA seq 246 aa AA seqDB search
MSVIGRIHSFESCGTVDGPGIRFITFFQGCLMRCLYCHNRDTWDTHGGKEVTVEELMKEV
VTYRHFMNASGGGVTASGGEAILQAEFVRDWFRACHEQGINTCLDTNGFVRRYDPVIDEL
LDVTDLVMLDLKQLNDEVHQNLVGVSNHRTLDFARYLAKRNQRTWIRYVVVPGWSDDDAS
AHQLGEFTKDMHNIEKIELLPYHELGKHKWTAMGEEYKLDGVKPPKADTMDRIKSILTSY
GHKVVY
NT seq 741 nt NT seq  +upstreamnt  +downstreamnt
atgtcagttattggtcgcattcactctttcgaatcctgcggtaccgtagatggtccaggt
attcgttttatcactttttttcagggttgcctgatgcgttgcctctactgccacaaccgc
gacacctgggatacccatggcggcaaggaagttaccgtagaagaattgatgaaggaagtg
gtgacctatcgccattttatgaatgcgtccggcggcggcgtaacggcatccggcggcgag
gccattctgcaggcagagttcgttcgtgactggttccgtgcctgtcacgagcaaggtatt
aatacctgtctggacaccaacggttttgtccgccgttacgacccggttattgacgaactg
ctggacgtgacggatttggtgatgcttgaccttaagcaactcaacgatgaggtgcaccaa
aatctggtcggggtatctaatcaccgtacgctggattttgcccgttatcttgccaagcgt
aaccagagaacctggattcgctatgtggtggtccccggctggagcgatgacgacgcttcc
gctcaccagttgggggagttcactaaagacatgcacaacattgaaaaaatcgagctgttg
ccttaccacgaactgggcaaacacaagtggacggctatgggcgaggagtacaagctggac
ggcgtcaaaccgcccaaagcggacaccatggaccgcatcaagtctattctgaccagttat
ggtcacaaagtggtgtactaa

DBGET integrated database retrieval system