KEGG   Dickeya dadantii 3937: Dda3937_03374Help
Entry
Dda3937_03374     CDS       T01305                                 

Gene name
pemA
Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ddd  Dickeya dadantii 3937
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Dda3937_03374 (pemA)
   00500 Starch and sucrose metabolism
    Dda3937_03374 (pemA)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     Dda3937_03374 (pemA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3580232..3581332
Genome map
AA seq 366 aa AA seqDB search
MLKTISGTLALSLIIAASVHQAQAATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFV
ILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAK
DFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTL
YVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQ
KYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHI
YGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGD
WTPTLP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacgatctctggaaccctcgcgctgtcgctgattatcgccgccagcgtacat
caggcacaggcagcgaccacctacaacgctgtggtatcaaaatcttccagcgacggcaaa
acgttcaaaactattgccgacgcgattgccagcgccccagcaggcagcacaccgttcgtc
attttgatcaagaacggcgtctataatgaacgcctgacgattacccgcaataacctgcat
ctgaaaggcgaaagtcgtaacggtgcggtcattgctgctgccacggcggcgggcaccctg
aagtcggacggcagcaagtggggaacggcaggcagcagcaccatcaccatcagcgccaag
gatttcagcgcccagtcgctgaccattcgcaacgactttgatttcccggccaatcaggcc
aaaagcgacagcgacagcagtaaaatcaaggacacgcaggcggtagcgctctatgtcacc
aaaagcggcgaccgcgcctacttcaaagacgtcagcctggtcggctatcaggacacgctg
tatgtttccggcggccgcagtttcttctccgactgccgtatcagcggcacggttgacttt
atctttggcgacggcaccgcgctgttcaacaactgcgatctggtctcccgctatcgcgct
gatgtgaaaagcggcaatgtctccggctacctgaccgcgcccagtaccaacatcaatcag
aagtatggtctggtgatcaccaacagtcgcgtgattcgggaaagtgactcagtaccggcg
aaaagctacggactgggtcgcccctggcatccaacaacgaccttctccgatggccgttac
gcggatccgaatgctattggtcaaaccgttttcctgaacaccagcatggataatcatatt
tatggttgggacaagatgtccggcaaggacaaaaacggcaacaccatctggttcaatccg
gaagattcccgtttcttcgagtacaaatcctatggtgcgggagctacggtgagcaaagac
cgccggcaactgactgacgcacaggcggcagagtacacgcagagcaaagtactgggcgac
tggacgccgacattaccctga

DBGET integrated database retrieval system