KEGG   Dickeya dadantii 3937: Dda3937_03374Help
Entry
Dda3937_03374     CDS       T01305                                 

Gene name
pemA
Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ddd  Dickeya dadantii 3937
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ddd00040]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ddd00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3580232..3581332
Genome map
AA seq 366 aa AA seqDB search
MLKTISGTLALSLIIAASVHQAQAATTYNAVVSKSSSDGKTFKTIADAIASAPAGSTPFV
ILIKNGVYNERLTITRNNLHLKGESRNGAVIAAATAAGTLKSDGSKWGTAGSSTITISAK
DFSAQSLTIRNDFDFPANQAKSDSDSSKIKDTQAVALYVTKSGDRAYFKDVSLVGYQDTL
YVSGGRSFFSDCRISGTVDFIFGDGTALFNNCDLVSRYRADVKSGNVSGYLTAPSTNINQ
KYGLVITNSRVIRESDSVPAKSYGLGRPWHPTTTFSDGRYADPNAIGQTVFLNTSMDNHI
YGWDKMSGKDKNGNTIWFNPEDSRFFEYKSYGAGATVSKDRRQLTDAQAAEYTQSKVLGD
WTPTLP
NT seq 1101 nt NT seq  +upstreamnt  +downstreamnt
atgttaaaaacgatctctggaaccctcgcgctgtcgctgattatcgccgccagcgtacat
caggcacaggcagcgaccacctacaacgctgtggtatcaaaatcttccagcgacggcaaa
acgttcaaaactattgccgacgcgattgccagcgccccagcaggcagcacaccgttcgtc
attttgatcaagaacggcgtctataatgaacgcctgacgattacccgcaataacctgcat
ctgaaaggcgaaagtcgtaacggtgcggtcattgctgctgccacggcggcgggcaccctg
aagtcggacggcagcaagtggggaacggcaggcagcagcaccatcaccatcagcgccaag
gatttcagcgcccagtcgctgaccattcgcaacgactttgatttcccggccaatcaggcc
aaaagcgacagcgacagcagtaaaatcaaggacacgcaggcggtagcgctctatgtcacc
aaaagcggcgaccgcgcctacttcaaagacgtcagcctggtcggctatcaggacacgctg
tatgtttccggcggccgcagtttcttctccgactgccgtatcagcggcacggttgacttt
atctttggcgacggcaccgcgctgttcaacaactgcgatctggtctcccgctatcgcgct
gatgtgaaaagcggcaatgtctccggctacctgaccgcgcccagtaccaacatcaatcag
aagtatggtctggtgatcaccaacagtcgcgtgattcgggaaagtgactcagtaccggcg
aaaagctacggactgggtcgcccctggcatccaacaacgaccttctccgatggccgttac
gcggatccgaatgctattggtcaaaccgttttcctgaacaccagcatggataatcatatt
tatggttgggacaagatgtccggcaaggacaaaaacggcaacaccatctggttcaatccg
gaagattcccgtttcttcgagtacaaatcctatggtgcgggagctacggtgagcaaagac
cgccggcaactgactgacgcacaggcggcagagtacacgcagagcaaagtactgggcgac
tggacgccgacattaccctga

DBGET integrated database retrieval system