KEGG   Dickeya dadantii 3937: Dda3937_03497Help
Entry
Dda3937_03497     CDS       T01305                                 

Gene name
folE
Definition
GTP cyclohydrolase I
Orthology
K01495  
GTP cyclohydrolase I [EC:3.5.4.16]
Organism
ddd  Dickeya dadantii 3937
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ddd00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2112750..2113418
Genome map
AA seq 222 aa AA seqDB search
MSAVLTKEAALVHEALLARGLETPLRGKMLESETRKRLIAEHMTEIMNLLNLDLADDSLA
ETPHRIAKMYVEEIFSGLDYANFPKITIIENKMKVDEMVTVRDITLTSTCEHHFVTIDGK
ATVAYIPKEGVIGLSKINRIVQFFSQRPQVQERLTQQILVALQTLLGTNNVAVSIDAVHY
CVKARGIRDATSATTTTSLGGLFKSSQNTRQEFLRAVRHHHN
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgtcggctgtattaacaaaagaagcggccctggttcacgaggcgctgttggcgcgtggc
ctggaaaccccactgcgcggcaaaatgctggaaagtgaaacccgtaagcgcctcatcgcg
gagcacatgacggaaatcatgaacctgctgaatctcgatctggcagacgatagtctggcg
gaaaccccccaccgcatcgccaaaatgtatgtggaagagatcttttccggtctggattac
gccaatttcccgaaaatcaccattatcgaaaacaagatgaaagtggacgaaatggtgacg
gtacgcgacatcaccctgaccagcacctgtgaacaccactttgtaactatcgatggtaaa
gccacagtggcgtacatcccgaaagagggcgtgatcgggttgtccaaaatcaaccgcatc
gtgcagttcttctctcagcgtccacaggtgcaagagcgtctgacccagcagattctggtg
gcgttgcagacgttgcttggcaccaacaatgtggcggtgtcgattgacgcggtgcattat
tgcgtcaaggcgcgcggcattcgtgacgccaccagcgccaccacgaccacgtcactgggc
ggcctgttcaaatccagtcagaatacccggcaggaattcctgcgcgcggtgcgccaccac
cacaactga

DBGET integrated database retrieval system