KEGG   Dickeya dadantii 3937: Dda3937_03699Help
Entry
Dda3937_03699     CDS       T01305                                 

Gene name
sseA
Definition
3-mercaptopyruvate sulfurtransferase
Orthology
K01011  
thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
ddd  Dickeya dadantii 3937
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Sulfur relay system
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Dda3937_03699 (sseA)
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    Dda3937_03699 (sseA)
 Genetic Information Processing
  Folding, sorting and degradation
   04122 Sulfur relay system
    Dda3937_03699 (sseA)
Enzymes [BR:ddd01000]
 2. Transferases
  2.8  Transferring sulfur-containing groups
   2.8.1  Sulfurtransferases
    2.8.1.1  thiosulfate sulfurtransferase
     Dda3937_03699 (sseA)
    2.8.1.2  3-mercaptopyruvate sulfurtransferase
     Dda3937_03699 (sseA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3550917..3551561
Genome map
AA seq 214 aa AA seqDB search
MMPDIDAFADALGKLGLNEQQHLVIYDEGNLFSAPRAWWMLRLTGASRISILSGGLAGWK
QQGLPLEQGDVSPTAQVFHAQTPAAGAIRSLDDVLALCRTGDEQIVDARPAPRFLGEVDE
PRPGLRRGHIPGSFNVPWSVLVEGGALKPADELAAIFHQAGVDIQRPIVASCGSGVTASV
VMLALFVLNAPQVSLYDGSWSEWGARDDVPVVTG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatgccggacatcgacgctttcgccgacgcgctgggcaaactggggctgaacgaacag
cagcatctggtaatttacgacgaaggcaacctattttccgcaccacgcgcctggtggatg
ctgcggctgacgggcgcttcgcgcatttcgattctgagtggcgggctggcgggctggaaa
cagcaggggctgccgctggaacaaggcgacgtctcgccgaccgcccaagtgttccatgct
cagacgcccgccgccggcgcgattcgttcgctggatgacgtgctggccctgtgccgcacc
ggcgacgaacagattgttgatgcccgccccgcgccccgttttctcggcgaggtagatgaa
ccgcgaccggggctgcgtcgtggccacattccggggagtttcaacgttccgtggagtgtt
ctggttgaaggcggcgcactgaaaccggcggacgaactggccgctatctttcatcaggcc
ggcgtcgacattcagcgcccgattgtcgccagttgcggctccggcgtgacggcatcggtg
gtgatgctggcgctgtttgtgctcaatgcgccgcaggtctcgctttacgacggttcgtgg
agcgaatggggcgcccgcgacgatgtgcctgtcgtcaccgggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system