KEGG   Dickeya dadantii 3937: Dda3937_03699Help
Entry
Dda3937_03699     CDS       T01305                                 

Gene name
sseA
Definition
3-mercaptopyruvate sulfurtransferase
Orthology
K01011  
thiosulfate/3-mercaptopyruvate sulfurtransferase [EC:2.8.1.1 2.8.1.2]
Organism
ddd  Dickeya dadantii 3937
Pathway
Cysteine and methionine metabolism
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Sulfur relay system
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:ddd00920]
Metabolism; Amino acid metabolism; Cysteine and methionine metabolism [PATH:ddd00270]
Genetic Information Processing; Folding, sorting and degradation; Sulfur relay system [PATH:ddd04122]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3550917..3551561
Genome map
AA seq 214 aa AA seqDB search
MMPDIDAFADALGKLGLNEQQHLVIYDEGNLFSAPRAWWMLRLTGASRISILSGGLAGWK
QQGLPLEQGDVSPTAQVFHAQTPAAGAIRSLDDVLALCRTGDEQIVDARPAPRFLGEVDE
PRPGLRRGHIPGSFNVPWSVLVEGGALKPADELAAIFHQAGVDIQRPIVASCGSGVTASV
VMLALFVLNAPQVSLYDGSWSEWGARDDVPVVTG
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgatgccggacatcgacgctttcgccgacgcgctgggcaaactggggctgaacgaacag
cagcatctggtaatttacgacgaaggcaacctattttccgcaccacgcgcctggtggatg
ctgcggctgacgggcgcttcgcgcatttcgattctgagtggcgggctggcgggctggaaa
cagcaggggctgccgctggaacaaggcgacgtctcgccgaccgcccaagtgttccatgct
cagacgcccgccgccggcgcgattcgttcgctggatgacgtgctggccctgtgccgcacc
ggcgacgaacagattgttgatgcccgccccgcgccccgttttctcggcgaggtagatgaa
ccgcgaccggggctgcgtcgtggccacattccggggagtttcaacgttccgtggagtgtt
ctggttgaaggcggcgcactgaaaccggcggacgaactggccgctatctttcatcaggcc
ggcgtcgacattcagcgcccgattgtcgccagttgcggctccggcgtgacggcatcggtg
gtgatgctggcgctgtttgtgctcaatgcgccgcaggtctcgctttacgacggttcgtgg
agcgaatggggcgcccgcgacgatgtgcctgtcgtcaccgggtga

DBGET integrated database retrieval system