KEGG   Dickeya dadantii 3937: Dda3937_03834Help
Entry
Dda3937_03834     CDS       T01305                                 

Gene name
arbB
Definition
phospho-beta-glucosidase
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
ddd  Dickeya dadantii 3937
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ddd00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2893493..2894893)
Genome map
AA seq 466 aa AA seqDB search
MMSNPFPAHFLWGGAIAANQVEGAYLTDGKGLSTSDLQPQGIFGEIVTRQPGDSGIKDVA
IDFYHRYPQDIALFAEMGFTCLRISIAWTRIFPQGDEAEPNEAGLAFYDRLFDELAKYGI
QPLVTLSHYEMPYGLVEKHGGWGNRLTIDCFERYARTVFTRYRHKVKRWLTFNEINMSLH
APFTGVGLPPDSDKAAVYQAIHHQLVASARAVKACHDIIPDAQIGNMLLGAMLYPLTSKP
EDVMESLHQNREWLFFGDVQVRGAYPGYMHRYFREQGITLNITAQDTQDLKATVDFISFS
YYMTGCVSTDEAQLEKTRGNILNMVPNPYLESSEWGWQIDPLGLRYLLNFLYDRYQKPLF
IVENGLGAKDKIEENGDIHDDYRIRYLNDHLVQVGEAIDDGVEVLGYTCWGPIDLVSASK
AEMSKRYGFIYVDRDDAGQGSLERRRKKSFYWYQSVIASHGKTLTR
NT seq 1401 nt NT seq  +upstreamnt  +downstreamnt
gtgatgagcaaccctttcccggcgcattttttatggggcggcgcgattgccgccaatcag
gtggaaggcgcctatctgaccgatggtaaaggactttccacgtcggatttacagcctcag
ggcattttcggcgaaattgtaacgcgccagccgggcgacagcggcatcaaagatgtggcg
attgatttttatcaccgttacccgcaggacatcgcactgtttgcggaaatggggtttacc
tgcctgcgcatatcgatagcctggacgcgcattttcccgcagggggacgaggcagagccg
aatgaggcggggctggcgttttacgatcggctgtttgatgagctggcaaagtacggtatt
cagccattagtgacgttgtcacactatgaaatgccgtatggactggtggaaaaacacggc
ggctggggcaaccgcttgacgattgattgctttgagcgctacgcccgcacggtgtttacg
cgttatcgccacaaggttaagcgttggctgacgttcaacgagatcaatatgtcgctgcat
gcgccctttaccggcgtcgggctgccgccggacagcgataaagcggcggtttatcaggcg
atccatcatcaactggtcgccagcgccagagcggtaaaagcctgtcacgatattattccg
gacgcgcaaatcggcaacatgctgttaggggcgatgctctacccgctgaccagcaagccg
gaagatgtgatggaaagcctgcatcagaaccgggaatggctgttcttcggcgatgtgcag
gtgcgcggcgcgtatccggggtatatgcaccggtatttccgggagcagggtattacgctg
aatattacggcgcaggatacgcaggatctgaaagccaccgttgattttatttccttcagc
tattacatgactggttgcgttagcaccgatgaagcgcaactcgaaaaaacgcgcggcaat
attttgaatatggtgccgaacccgtatctggaaagctctgaatggggatggcagattgat
ccgctggggctgcgttatttactgaatttcctgtacgaccgttatcaaaaaccgttgttt
attgtcgagaacggcctgggcgcgaaagataagattgaagagaatggcgacattcatgac
gattatcgtatccgctacctgaatgatcatctggtgcaggtcggcgaagctatcgacgac
ggcgttgaggtgctgggatatacctgctgggggccgattgacttggtcagcgcctcaaag
gcggaaatgtccaaacgttatggctttatttatgtcgatcgtgatgatgccggtcagggt
tcgctggagcggagacgtaaaaagagtttttactggtatcaatccgttattgccagtcac
ggaaaaacgctgacgcgataa

DBGET integrated database retrieval system