KEGG   Dickeya dadantii 3937: Dda3937_03839Help
Entry
Dda3937_03839     CDS       T01305                                 

Gene name
ung
Definition
uracil-DNA-glycosylase
Orthology
K03648  
uracil-DNA glycosylase [EC:3.2.2.27]
Organism
ddd  Dickeya dadantii 3937
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:ddd00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Dda3937_03839 (ung)
Enzymes [BR:ddd01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.27  uracil-DNA glycosylase
     Dda3937_03839 (ung)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3616697..3617383
Genome map
AA seq 228 aa AA seqDB search
MTTSLTWHDVLAQEKELPYFVNTLSFVHQERTAGKVIYPPQKDVFNAFRFTEFHAVKVVI
LGQDPYHGPNQAHGLSFSVRPGVPAPPSLVNIYKELANDIPGFEIPSHGFLQSWAQQGVM
LLNTVLTVEASKAHSHANLGWETFTDKVIEKLNTHREGIVFLLWGSHAQKKGSIIDTQRH
HVLKAPHPSPLSAHRGFLGCHHFSRTNQLLEQQGDTPIDWTPRLSENA
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaccacttccctgacctggcacgacgtgctggcccaagagaaagaactaccctatttc
gtcaatacgttgtcgttcgttcatcaggaacgtacagcaggcaaggtgatctatccgccg
cagaaagacgtcttcaacgcctttcgttttactgagtttcacgctgtcaaagtagtgatt
ctggggcaggacccgtatcacggcccgaatcaagcgcatggactgtcgttttcggttcgc
ccgggcgtgccggcgccgccgtcgctggtcaatatctacaaagaactggctaacgatatt
cccggatttgaaattccttcccacggttttttgcagagctgggcgcagcagggcgtgatg
ttgctcaataccgtgttgacggtggaagccagcaaagcgcattcgcacgccaatctgggc
tgggaaaccttcaccgacaaggtgatcgaaaagctgaacacgcaccgggaaggaatcgta
tttctgctgtgggggtcacacgcgcaaaagaaaggcagcattattgatacacagcggcat
catgtgctgaaagcgccgcacccctcgccattatctgcccaccgcggttttttaggatgc
caccatttctccagaaccaatcagttgctggaacaacagggcgatacgccgatcgactgg
acaccccgcttgtcggaaaacgcctaa

DBGET integrated database retrieval system